Donations are essential to keep Write Out Loud going    

Popular last 30 days

Love Life poem Nature family War spiritual poetry loss sadness

Popular last 12 months

love poetry life poem Nature death hope War loss poet

SLIGHT DELAY

The speed of light is considerably faster than the speed of sound

That's just one of nature's great mystique

So when you meet a person who appears to be bright

Wait until they actually speak

Read and leave comments (0)

Also by Joe Marcello:

SOME DATE | A LITTLE ADVANTAGE | NO ILL WILL | 401-K9 |

April 2020 Walpurgisnacht Collage Poem

Overtaken by cyclists heading into sunrise in your dreams  

Broke grains on Monday, counting red angels

Drunk on darkness smiling on the shadows

A phone call only a shadow away from your fingertips

We are the survivors stunned, in Stockport

Digging deeper, reflective

Talking to the walls

Church bells toll for every day without a death

We are the poets leaving our words open...

Read and leave comments (1)

Also by Stockport WoL:

April 2020 Lockdown Collage Poem | March Lockdown Collage Poem |

Collage PoemStockport Write Out LoudWalpurgisnacht

The Free-Spirit


I'm heading out now,
not sure what
time I'll be back. 

I might decide
to visit someone who
I haven't seen in a while
Or take a trip
to somewhere
I've never been before. 

I'll be back
but I'm not
sure when yet.
I might go walking and
bump into someone
and then
start talking. 

We might end up
going for a drink or two.
Who knows what will
happen when I walk
out that door? 

...

Read and leave comments (0)

Also by Emer Ní Chorra:

Theresa's Garden | You | Slippy lust | Womb an | Lessons in Love | Wounded | Show me the way to go home |

Hetaclitus the Obscure

Heraclitus, a Greek philosopher born in 544 B.C. said, “No man ever steps in the same river twice, for it's not the same river and he's not the same man."

 

 

Heraclitus, my friend, I know you've been gone

For two and a half thousand years but we are of one mind:

Sceptical, Seeking, Secular.

On a road through Physics and Mathematics

To a Singularity of belief

Foretold in th...

Read and leave comments (1)

Also by John E Marks:

Isolation | The hell and the heft of it | 1995 | A LETTER TO FOUR DAUGHTERS | Writ in water | i.m. Thomas Hardy 1840-1928 | Himalayan Greeks | At Kathy's funeral | Meltdown | Young love, and old | Redemption song | A loving heart is truest wisdom | Lightning and Trees | Austerity | Viral irony | Tomorrow Belongs to Me | i.m. Paul Leon d.1942 | Tiny Victories | Haikuesque | The Eyes have it | Biba | Tabula Rasa | Stockholm syndrome | Light waves to Schrödinger’s cat | Whitechapel, 1878 | Speed of the sound of self-isolation | Philosophy or Poetry | Vanishing point | A satire: of sorts | Día de Muertos | A lamentation | The wise fool | A northern sky | The Doors of Perception |

Yet Untold

Grind the wheat upon the stone that we may bake the masters bread,

Bind the feet to shape the bone and lay down in the masters bed,
It’s a cold hard trope to grip the throat and stop the screaming,
And a bold heart’s hope could slip its rope and drift if it just stops believing,
Hold hard to the seamless, senseless dreams of yesterday,
Cold hearts cannot seem to dream those dreams again tod...

Read and leave comments (2)

Also by Jason Bayliss:

Broken Toys | The Last Fish | 12.25 | Licking Handrails | ? | Give Me The Armour | Humanity's Insanity | I Lean Towards The Light | Yesterday's Me | Goodbye At The Door | Birdsong | Balancing The Ledger | Needle Point | The Forge | Wingless Angels |

DANCE ON

When life leads you a not so merry dance

As a partner of passing circumstance,

Step out to meet its fitful tune

With hope and you will find that soon

The dance will change - and you will too -

So keep in step and follow through.

Until the not so merry dance

Comes to an end and life will chance

To change its tune and see your feet

Skip readily to a happier beat.. 

.......

Read and leave comments (2)

Also by M.C. Newberry:

I LOVE YOU TODAY - an old love song revised/reprised | JUDGEMENT DAY | APRIL 23 - A QUIET CELEBRATION | GRETA'S BACK! | WE TWO - more fun to upset SOMEONE somewhere! | THREE WORDS | TELL HER - a lyric on the bright side | YOU TOO! | MAKING WAVES - A second coming of an unwanted sort | STATIONS | TEA FOR ONE - today's govt. approved version of an old song |

breeze

You’re standing still at the top of a hill, the breeze gradually increasing, staring intently at he picturesque view of the voracious desert terrain that could ultimately devour you with a single touch. the breeze has been blowing, constantly blowing for many months, you forget what it was like to have still, calm air around you. But the breeze is picking up, you start shaking, not because of the ...

Read and leave comments (0)

Also by f8:

complications |

lifedeathpainsuffering

Workin' On It---A Poem by O.L. Buzzerd

 

When you are retired

and don't have no clock to punch

no deadline to meet

no threat hangin' over your head

it is so easy to come up with an excuse

for puttin' things off

 

why screw up your whole day

doing somethin'

when you can just do nothin' instead

 

and yet I was raised

to always be doin' somethin'

idleness is the devil's workshop

they used to sa...

Read and leave comments (1)

Also by d.knape:

When The Gloves Come Off | Sheepless In Seattle | Eulogy For Trees | The Silence Of Strangers | The Poem That Got Away | MUD PIES | A DOG'S LIFE | Their Song | Vine | Working From Home | Teleconferencing | Caveman Poetry | Raindance | Risky Business | WINDOWS | Notice From Management | Used Cats | All Of The Above | Ceiling Fan | LEAKS | About This Poem | I Don't Get It | Conspiracy Theories | Simple Pleasures | Don't Mind Me | STIFF |

The Lodger

The Lodger

 

We let him in

And he stayed

 

He had been pleading

Out there

Wanting somewhere to stay

 

At first we thought he was just like all the others

Some fly-by-night who would be here then gone

 

But no

He wanted to hang around

 

He was everywhere

Into everything

He made us change our daily routine

He was probably in the kitchen (and we w...

Read and leave comments (2)

Also by Ian Whiteley:

The Sunshine Is Ginger & White | My Mother's Kitchen | Harsh Review | In Another Place | Thirteen Minutes From Home | All Hail The Great Sultana | USA | There Are No Bad Ships Or Winds, There Are Bad Captains | I’M FEELING KNACKED (based on a very bad translation of EINE FRÜHLINGSNACHT By JOHANN WOLFGANG VON GOETHE) | A Bracelet Of Daisies | The Small Things | The Dancing Light Of Candles | C90 | The Side Kick | Glam Rock Man | Death May Be The King Of Terrors | Orchard Lane | Plague Mantra | The Mandrake Curse | False Prophet | Teardrop | The Next War Is Here | Strictly Bin Dancing | Tree Man | Painting By Numbers | The Loop At The Edge Of Reason | Indebted | Overnight Stay | Marbles |

napowrimo2020day 30covid 19lodgerreturnsecond spikefearin houseinfectionwarning

We Must Be Fair To Belinda

Like small children divorces are messy

Legal fees only add to the frustration

But perhaps the hardest thing of all

Is coping with an ex-partner's indignation

 

It's not easy but we must be fair to Belinda

She gave me the best years of her life

After all she is the mother of my kids

She was, all in all, a half-decent wife

 

Of course dear, you are my partner now

Bel...

Read and leave comments (0)

Also by simon lucan:

Outside Right | The Chapel on the Hill | Five Goslings | Old and Out In the Cold | The Night I Walked Out on Grey Hair | Falkirk 1943 | Whirlpool | Benchmark Woman | SIghing With Swans | The Up-Side Of Lock-Down | Locked Down Locked Out | Barefoot Girl | Domestos Daze | Your Steps Were Small But They Came To Me | The Hours That Blackbirds Keep | Quiet | Yellow | Crumbs | Looking Down At Your Shoes | Beryl Burton (1937-1996) | Girl On A Narrowboat | On Rock Street | Farewell Norman Hunter | Waiting For The Owl | Frogs | Out Of The Backwoods | Hailstone Girl | Coronaverse | Facing Up To Eve | We've Not Had Fun For Ages | Requiem For A Denon | I Still Can't Believe the Depths I've Sunk To | The Other Side of Ragwort | peculiar mannerisms | Starfish Haze | Forest Green |

divorcemotherkidswife

Corrigendum : Blue Scarf Yellow Suit

It was actually green and I hadn’t any clue

I penned down lines thinking it’s blue

Stanza after stanza inspired by the subject

Perhaps I was mesmerized, perhaps it’s true.

 

The subject threw light on my thoughts

And I weaved praise of all sorts.

There was a gush of guilt within me then,

While my poem had topped the charts.

 

Reception wrong yet the lines made some se...

Read and leave comments (0)

Also by ai ou:

नीला दुपट्टा पीला सूट (Blue Scarf Yellow Suit) | Stay Alive! | Omen or Intuition? | Answer To Your Cries... Moon Girl! | Dear Goddess, Mercy! | खुदाया खैर! खुदाया खैर! (Hindi) | I Am Not The Only One | Moon.Girl! | She is... She is... A Plastic Doll |

beautiful womanangel

Ode to those who Care

There is something about the selfless people

whose life perspective

is aligned to the weak and feeble

It's almost as if they can feel the pain

and see the strain of those to whom

they empathise yet not just sympathise 

Being careful not to make routine

their angelic and compassionate deeds

They choose not recognition

but to go unseen, quietly carrying on.

Sometimes un...

Read and leave comments (0)

Also by Rick Varden:

LOCKDOWN! | Vicious Cycle | The Fear |

Room for creamer

Eyes gone dull, receding into comatose
Fingers full of dirt and hope, spinning sunflower
Power and lack thereof, the perception of those above looking down at the masses
These clashes seem to me, a supply chain theory, I want what you got, bombs pour out
Military industrial ore, we pour out the lifeblood of our children for soil
Foil snake, famished toil, napalm boils your tea
Three, one two...

Read and leave comments (0)

Also by sandbar:

Mule deer lights | Plastic plague | 3:25 | Umbilical | Bacteria culture | Ardea herodias | West South stain, passed daily | Condition: Human | Assembly line insanity | Asphalt us | Nyx/Nox | 11:58 & a stack of pennies | Dry Aloe | Bacteria culture | Slave of the flies | Bimaculoides | Cauterized wire heart | Ceelo | Smoking lamp | Tare tare tare 0.00 | The moon is shooting lightning bolts | Black mulch | Sleeping with spiders | Ardea herodias | Antifreeze | Dry heaving for breakfast | I'd walk a mile for a Camel | Corduroy | Slave of the flies | Words for Sirikit, wherever you are | Burn white sage in every corner | Concrete swan diving | Musca domestica | Melting plastic crowns | Mandarin, Clementine, Naval |

Counting Crazy Lovers

My first lover fast and wild

Went and robbed herself a liquor store as a child

I met her after her ways with a gun

She didn’t need no bullets to make me dance none... son

 

My second lover loved the Grateful Dead

She had stars in her eyes, acid in her head

She danced to music like a woman possessed

Feet firmly in the clouds and dancing breasts

Yet I digress

 

Cause...

Read and leave comments (4)

Also by Michael Triandam:

Don't Leave your Discrimination with your shoes by the Door | Sad Poem | Monsters | What the Times did not Say | Ghost Eye |

The new normal

Piled high in your fridge, happiness abounds;

Open up the chill, imagine sights and sounds:

A lightly oiled couple, crisply tanned,

Lie ready and impatient on the sand.

He looks like Mister Universe;

The cash is bulging in her purse,

And no one thinks it is perverse

That honest, sweaty fun's at hand,

For them and for you;

You can have it too.

Take it out,

Thaw it o...

Read and leave comments (0)

Also by Stephen Gospage:

Desert Island | Moon River |

Fool

And i tried to listen to you
The more I listened I fooled you
You dont really get what i mean

And the words coming out of your mouth
dirty ragged and worned out
Wont really get you to your means

With a Word you locked my vision
Suddenly apeared division
Betwen whats real and what had seemed

You dont have to try hard 
What was once there has sailed away
But I'm finally on my feet

Read and leave comments (1)

BBQ vodka (04/29/2020)

cues caught in smoke 
swallowed iron, made malleable 
by the heavy forkes tongues
of embellished pleasantries. 

in the coals, we pray 
to find our best selves 
And thru temperance 
make them better. 

ride, pale horses, ride 
ride wretched and clean 
vein-sewn with pride : 
a vanity too large 
to seek the the small and deep fissures
wherein lies the livelihood of 
us: sooten worsh...

Read and leave comments (0)

Also by Zach Dafoe:

tide pod (04/25/2020) | (untitled) |

Tyrmelrakkivitarno gods no mastersApocalypse

Mammogram Blues

I went for a mammogram the other day

not cause me boobs were sore

It's just routine they said

Just to be sure.

 So I went to the screening unit

And saw this big machine

Nurse said strip tut waist love

Don't worry it's nice and clean

She plonked me boob on a cold plate

It fair made me shiver

This machine started to descend

And me knees started to dither

Well! it ...

Read and leave comments (0)

Also by Hazel Connelly:

Every day is Sunday |

Phantom

Have I became a phantom
Fading from your mind
Or is my heart not tied in right
Check under your cabinets
I'm just a phantom

I feel so ignorant for loving you
When I knew you were just hurt me again
I know this is stupid of me
I was really hoping that you could just love me

Was is it that I can't be important to anyone
Do you get it yet?
I blame myself for everything
I beat myself u...

Read and leave comments (1)

Also by Mikey V Kinsey:

Goodbye | She Was My Only | The Outcasts | Escaping | Close | Glass | What The Hell | Cherry Blossoms | April | 1-800-273-8255 | Love/Wait | Love |

Natasha

She came to the city, left the farmland behind

Eighteen years old, excited to find

A life so much different to the one she had left

Not knowing that soon, she'd leave her family bereft

 

Into the night scene, she found a place

Where she could be she but at a price

Swiftly the attention of those with intentions

Was drawn to the beautiful, naive Natasha

 

Soon she was p...

Read and leave comments (0)

Also by Grace Poller:

Corona - The Homeless Man |

Metamorphosis

Didn't recognise who the smile came from

remembering the chrysalis child.

Metal entwined teeth, tangled hair,

a nose too large for a little face,

unhappy self-doubting eyes,

the too tall insecurity and gawkiness.

Now suddenly transformed into a butterfly,

blessed with gazelle-like grace

glowing skin, shining tresses, sparkling eyes.

The drastic effect of the hated metal

...

Read and leave comments (7)

Also by Jennifer Malden:

Doing it Gingerly |

I am high on your Love!

I am high on your love

My love for you has reached to the madness, the each passing day

Your warm touch and love-filled eyes have stolen my days & nights

I love you as deep as the sea and as high to the moon

 

You will never know how much I love you

It couldn’t be explained in words how much I adore you

Your sweet smile sparkles my life like a fluorescent moon in the sky

Yo...

Read and leave comments (2)

Canvas

A canvas was given to do with as you like
An empty page given for you to behold your insight
To lay down your visions and secret desires
Only to him to be revealed

The canvas before one’s eyes
Empty was it received
Endless possibilities, not set in stone
Many came and left their marks
Some everlasting beauty while others stains

Many fingers but not the same hand
Some gentle while oth...

Read and leave comments (0)

Also by Mocosy:

Communication | Interplay | Dance of life | Thoughts | New Beginnings | Illumination | Letting go | Contemplation | Just Breathe | Quietness | Trust | The day i met you | Memories | Thoughts | When i think of you | Searching | Dare to be different | Knowledge | Tapestry | Life | Trust | Beyond eyes can see | Voices | Collateral Beauty |

The Fairy’s Tale

 

There is a place 

Where the stories 

are real

And their tellers 

Are not 

Where the dreamers

Lay awake 

And the lovers 

Wrap and unwrap 

Like beautifully crumpled 

Unwanted presents

Where people 

can fly

And animals 

can talk 

Where the flowers and trees 

Cry 

At the loss of their leaves 

And the snapping of 

Their branches 

Where th...

Read and leave comments (2)

Also by Twilbury Wist:

Bubbles of speech | These times |

YER PILUM

Your Roman pilum ranks alongside the English longbow as one of the great weapons of warfare.  At school, in Latin, we translated it as “spear”, which does it about as much justice as calling Beethoven a “pub turn”.
It was around 6’ long, the heavier shaft accounting for 4’, with a narrower spike of around 2’ at the business end.  The tip of the blade had a pyramidical point.  As a killing machine...

Read and leave comments (0)

Also by John Coopey:

NO PARTICULAR PLACE TO GO | "YOU LITTLE TOE RAG!" | SHALL I COMPARE THEE TO A SUMMER HOUSE? | THE BATTLE OF MEDWAY | UNIVERSAL KILLER | "SCRATCH" | THE WORLD IN BLOOM | CLAIM OF PHONES (5G) | KEEP TWO METRES TO BE SAFE | PEE ON ME | STICKKITA WOK ON? |

Thoughts in Times of a Pandemic

Here I find myself thinking about what I have always said: human beings are fragile and things can and will change in a blink of an eye.

As if things were not complicated enough in our beaten-up world; the terrible and endless civil war in Syria, the provocative bravado of North Korea, the continuous fights and rants of Trump with allies and adversaries, Putin's permanent interference in everyt...

Read and leave comments (1)

Also by Noris Roberts:

Without saying anything | Like abandoned papers... |

humanitysocietycoronavirus

wind

Fall in here
into this room
into this life
into this home
like a golden leaf
floating through the window
on a warm summer breeze

A gentle push
that changes your way
and brings you
to me

I´m waiting for you

Read and leave comments (2)

Also by Liam Osaneo:

Lie | Spring | real | You | Cold | Go away |

loveFatehope

LOVE AFFAIR

I fell in love with music again today,

so hard when life gets in the way. 

My dedication was no sacrifice

I took my own advice

sat down to let it flow

down from that upper region

to the hands that know

where age suddenly falls away

and I fell in love with music again today. 

Read and leave comments (11)

Also by ray pool:

CYCLICAL LAWS | DAMNED POETRY |

To you, who gave everything...

To you, who gave everything…

To you, with your empty words,
hollow promises and lies
To you, who ignored simple orders
to stay at home, just stay inside
To you, who scam the vulnerable
exploiting their struggle and plight
And to you, the perpetrators of abuse
the fear you create, is all we despise

You gave nothing, absolutely nothing 
In our darkest hours, this tragic time

But to ...

Read and leave comments (2)

Talking to myself

I’m so alone

Está llorando,

No sé cuando terminará.

Si supiera:

Podría ayudarnos.

Estoy tan sola.

Read and leave comments (0)

Also by Sophie:

Norma’s genes are not human | Buried alive |

It will take time to clear the mess.

The moon stirs anger in the sea.

Gale force winds gust with menace.

Together they whip up colossal waves,

wrecking the ancient sea defences.

 

Harbour is a boiling couldron,

fuelled by horizontal rain.

Boats are torn from their safe moorings,

and are reduced to fragments.

 

Rapid rivers leap over their banks,

uprooting trees in a rage,

transforming land into ins...

Read and leave comments (2)

Also by Abdul Ahmad:

Prayer for the safety of the old man | Natures healing powers | Life long friendship | Incarcerated indefinately | Noise isn't always intrusive | The Bridge Grandmaster | Service only fit for a mother | Eureka | Haiku | Walking in your foot steps | Not any different | Haiku | Haiku | Haiku | It were nowt but a dream | Thank god for a welcome companion | Picture of hope and dream | What's it called? |

Damned love

Damned love

I wonder if you think of me

the way I used to think of you

in that youthful glimmer

of sequined untainted hope

I wonder if you dream of me

the way I used to dream of you

lying in love-soaked sheets

charged with electric sweat

I wonder if you search for faces

the way I used to search for faces

desperate glimpses in a lonely crowd

singling out similar ...

Read and leave comments (1)

Also by Rachel Moore:

Love Hope. - inspired by a line in Roisin Kelly's poem Easter | Today |

The plight of the homeless hospitality workers sacked

A surge of unemployed restaurant workers are sent,

Onto the streets of London, unable to pay their rent.

Trafalgar Square at night is silent and empty.

But for the homeless rough sleepers, there aplenty.

 

Hundreds of tents and cardboard box encampments appearing,

Life under lockdown hundreds of catering jobs disappearing. 

The city day centres have closed ,no place to wash or...

Read and leave comments (3)

Also by hugh:

The tooth will out | The determination of a mother | The virus is sweeping through care homes at an alarming rate | Coronavirus the carehome curse | A delve into the mind of a burglar during the coronavirus crisis | Teenagers | Appendicitis | Avoid eating birds !!! | Sammy the spider | Do something now You are the Boss | The disease detectives must tackle the storm | Coronavirus ,I hope we never get it. |

The Get-away Girl

In our home with three sisters privacy was unknown.

Sometimes I craved solitude and quiet to read a book!

I had bolt holes.

 

There was always crawling under a bed quilt.

But that was glaringly obvious, stuffy and dim.

And the blanket pulled on my hair.

 

A roomy closet with a flash light wasn't bad.

But awkward balancing the book and the torch

And turning pages with ...

Read and leave comments (7)

Also by Cynthia Buell Thomas:

Political Science | Art or Action | Spring Canopy and Other Thoughts | Magpie in the Morning | The Dentist #2 | The Young Minister | Sky Watcher | Jack Knives! | Confrontation |

Delusion

Away from the crowd and rays of the sun
are the moments I cherish the most,
It is when, your wisdom
outbreaks from the dam of your lips,
which usually gurgles teases, jokes and laughter
(not intended for me, of course not)

you voice your
dreams and aspirations
painting a rainbow
on the dark night's sky,
and somewhere else aswell...

as well as your insecurities
in a sober expression...

Read and leave comments (0)

Also by Poetique:

What COVID-19 taught me |

lovemiserydelusion

Losing to Win

I lost you the moment I won you,
Coz you are not ME,
You belong to yourself,
You think like yourself,
You speak like yourself,
You sing like yourself,
You dance like yourself,
You laugh like yourself,
You cry like yourself,
You live for yourself…
You are not mine…
For me, it’s fine…
Coz I love to stay with you,
Battle of opinions, I love to play with you…
Why twinning every time?
Th...

Read and leave comments (0)

Also by Raavi Patel:

REGRETS |

egolovecompromise

BEAUTY

I see the beauty of the world.

The wonder of life.

The freedom in youth and the joy of a dream and purpose fulfilled.

I see beauty in the rewards of hard work and dedication.

The delicacy of it all.

I see people not realizing how fragile it all is and how it could disappear in the blink of an eye.

Idling away and carelessly going through their days.

I also see pain, suffering,...

Read and leave comments (1)

The Killer

The Killer

Like a vampire in the night
He brought an unseen fight 
A killer so silent
Yet so terribly violent

He's power, bending presidents to his will
Whole countries brought to a standstill 
China came first
But this did not quench his thirst

Millions got infected
Even the highly protected
Everyone was in danger
From this unwelcome stranger

In his eyes, we are equal all the...

Read and leave comments (1)

bees

i think you’re smart
i think a lot of things, actually.
i think if i could ever win your heart
but i think that’s silly.
we’re friends, aren’t we?
friends don’t love each other.
that’s how you see me,
as a friend and not a lover.
and that’s all you’ll ever see
and i can’t change that.
you stung me like a bee
like a pain through the heart.
all of this because
i think you’re charming, w...

Read and leave comments (2)

Also by Lucas Esemplare:

Bugs | Of All | Home | Search | The key | Liar’s World |

SAY I'M EXTRA

SAY I'M EXTRA

jacked up i get
when feeling paaionate
say i'm extra
i answer you bet
as you can see
hasn't stopped me yet
each new dawn
gotta verse for my song
trail blazers on
time to get along
seize the day with lust
boots kickin up dust
not a second to waste
too much life to taste
forget apathy
gotta express me
yes i get excited
when i'm delighted
laugh and sing
celebrating
...

Read and leave comments (1)

Also by cindylee loucks:

MOTHER EARTH | PAPER DOLL | STICKS & STONES | WISH I WERE |

POEMS3 by cindy lee loucks

Chuck Berry's Ding-A-Ling

Halfway through the year I knew

I wouldn’t make the grade.

A freezing night in ’72,

the time of Bloody Sunday.

Tension in Coventry.

But rock and roll

can save your soul.

Johnny B Goode,

lift me from my misery.

 

I had nowhere else to go.

The duck walk, Nadine, Carol,

Maybelline, and that novelty

song that must have

eaten half the set.

The wolfish grin,

...

Read and leave comments (7)

Also by Greg Freeman:

A long way back from the front line | Hair today, and tomorrow | The junk room | A day in our lives |

A Beautiful Storm

Love is like a beautiful storm.
Calm and soothing,then chaotic and wild. It can open your heart, making it vulnerable, making it open, making it raw. It makes us surrender a part of ourselves. A part of our vulnerability in the hands of another. Always love fiercely without fear. Never change the way we love, the way we laugh, the way we sing.

Love with a pure heart ❤️

 

 

 

 

 

...

Read and leave comments (0)

Rage

Every word I pretend not to hear

riddles me with fear 

I stick it in a cage

it fuels me for another day

Why do I feel this way?

Read and leave comments (1)

Rare Flame❣

To love a flower is the breaking of rules.                To break the rules ,well that i would do for you,dancing to clownfull tunes.

Rhythm of a bread crum,falling to the ground,a friend for just some,happy moments to remember,holding on to treasure,i need a friend like you forever.

Broken days are yet to come,but we must not forget the fun. I'm here to stay forever even if i'm far away. I...

Read and leave comments (0)

Gypsies***

There's a song circling along

In the deepest core of my heart

Just wanna share my love with you

Just wanna be my crazy self for you

It's all the smile that it takes to get the glow 

Glittering alleys and happiness that follows

Ive been humming like a bumble bee

A song circling right within me

Just wanna share my world with you

Just wanna rip my heart open for you

So c...

Read and leave comments (0)

Not on the Label

Covid-19, I heard him say

Does a big number on the lungs

To help to keep this thing at bay

Should we spray Dettol on our tongues?

 

The waiting game is such a bore

Cleaning products might be the key

At least until they find a cure…

Perhaps Harpic's the one for me?

 

Now Duck Deep Action, I could try

But I'm not one to splash the cash

And I suspect the dose is hi...

Read and leave comments (1)

Also by David Lindsay:

Sore | Conspiracy Theory |

Your Words

"I love you"

Three words with pure feelings 

Words kept us alive 

Words showed affection 

Baby, your name was my word

The word 'love' was you 

You were my world 

But 

Your words were hell for me

Unexpected from your mouth

Stung my heart deep

I wish I never heard it 

I wish you never uttered it

Your words have made me doubt myself

Your words have made me fe...

Read and leave comments (0)

On The Thirteenth Hour Bloodbath Ends

Domestic row

heated words

temper overload

killer impulse

fake patrol

police imposter

lethal weapon

unsuspecting victims

slain repeatedly

weekend massacre

Sunday showdown

thirteenth hour

bloodbath ended.

Read and leave comments (2)

Also by Nigel Astell:

Pushing Boundaries | Easter Boxed In | Tomorrow says Wait and See | You're Dead Meat |

Still counting body bags

A New Day Is Dawning

The Birds are alive Conversing with one another . Their faint little tweets like music its self . When this sound is Recognised . It's a sound of life . A new beginning . With lives lost a new life . A future and hope . For all to forgive . A New life is born . We try to forgive . We have to forgive . Without life . We have no beginning . Within Life we Will Forgive .

Read and leave comments (0)

Also by Wendy A Higson:

Our Thoughts Are With You | Power Talks | Sole Destroying | I Want | Wagging Tongs |

The World in Lockdown People's Poem to be curated by Barry Woods and Michelle Wright

Wirral poets Barry Woods and Michelle Wright are curating a people's poem during the UK lockdown period. The poem is, at present, ten pages long and will be launched online on May 11th. 

Facebook@worldinlockdownpoem

Read and leave comments (0)

BarryWoodspoetpoetrywirralMichellewrightWorldinlockdown

Likeness In Modern Art

      I'd spent an eternity 
constructing my dream home.
Today I began to wonder
who it is suitable for- certainly not me.
A  bee, unaware of a way out, finds it by chance.
I began to cross the road...pity me
it's always from the side you're not looking
-the inside-
the speeding truck descends upon you.
      Well, here I am waking up 
after total oblivion, no problem at all.
No worries...

Read and leave comments (0)

Also by Adam Whitworth:

Zen Flesh, Zen Bones | For The Pained Spirit | Ghazal | The Old Women Are Weaving | New Problems, Same Solutions | The Clouds Should Know Me By Now | Living Poetry | Get Outta Town |

Camping Memories

Oh how I loved to go camping 
in a tent in the back yard,
in the campgrounds of the Smokies, 
on the coast of Nova Scotia, 
with the Dories in Grand Canyon, 
in the Everglades of Florida,
wherever the places may be. 

Each trip was different, with its own adventures 
that brought a kaleidoscope of images,
a patchwork of memories.
each memory vivid and distinct,
of different times and p...

Read and leave comments (1)

Also by David F. Freeman:

Hinges of Hell | Young Love By the Sea | I Will Never Lie | Honey Boy | Hayloft Memories | Grief | Geezer's Lament | Dear One | Cold Feet | Chatterbox Motormouth Yackety-Yak Yada-Yada (Take your pick.) |

campingtravelnature

I Died Yesterday...

I died yesterday

With a pen in one hand and a diary in the other. 

The latter's pages were inlaid 

With prints of my curry stained fingers, 

And splotches of tea, 

And smudges of ink, 

And spools of memories,

And streams of ridiculous cravings. 

I fashioned the contents with the loose threads 

I'd been stockpiling since forever. 

Vibrant, prismatic, but half-completed...

Read and leave comments (1)

artcurrydeathdiarymemoriespagesPoetrysecretstea

WE live by the hands of others

We live by  the hands of others

Not seen by you or me

 

They pass the parcel

Stand at the till

Nurse the wounded

Or keep order

 

We live  by  the hands of others

Not seen by you or me

 

Our hands scrubbed clean and safe

 

But…

 

We  live by and are grateful to others

Who have to live day by day with that terrible fear

Read and leave comments (0)

Also by David R Mellor:

The Daily Count of Lives | This Mortal life |

NHSCorona virus

Let's Talk

How we communicate with others

those vibes we send out

our personal power

creates our life

our relationships

our World

energy, pure and simple

Chi

Prana

lifeforce energy

our emotions sending out these waves of power all the time...creating and manifesting...us

 

www.deanfrasercentral.com

Read and leave comments (0)

Also by Dean Fraser - The Quantum Poet:

Talking To Myself | The Shaman In The Park | All Roads Leading To The Eternal Now | London and Art | The Ancient Tree | The Spark of Understanding | Art Of Being | Acting Upon a Dream |

inspirationspiritualgrowth

The gathering of crows

My minds grasp, for sleep 

tolls heavy on my sanity, as

insidious eyes; pry, their beaks foul 

in the fissures of my mind

fears creep; freed, to be fed upon

to be mantled by the feathered wings 

of darkness 

night-tide rises; the gathering of crows

drags me deep, 

into the belief, of paranoia

Read and leave comments (0)

Also by DESMOND CHILDS:

(untitled) |

Happy World Book Day

Books can make you smile ,

Books can make you cry ,

Books can heal your mind ,

Books can make you kind ,

Books are your life light ,

Books encourage you to fight ,

Books will make you smart ,

Books will never break your heart .

Happy international book day .

Read and leave comments (0)

book

(We)ave

We
whisper
love into
skin locking
ourselves
away from
this
world;

we
vault
every
memory,
guard
every
breath,
bodies slick
with stolen
time;

every
moment
together,
a living
sanctuary.

Read and leave comments (2)

Also by Abruvanamedsly:

Soaring |

lovedcoupleromance

Truth is light

Truth is light

Tuesday,21st April 2020

 

God has sent us as messengers

and to remain as followers

tom pursue the truth as way of life

and never get afraid of torn strife

 

when question comes to face the truth

never hesitate to ask for proof

evil forces may raise the head

and compel you to remain dead with silence

 

this is where they go wrong!

and want ev...

Read and leave comments (0)

Also by Hasmukh Mehta:

Born free | Life to move on |

Jadia4708au

A Council of Twelves For Counsel of Life

A Council of Twelves For Counsel of Life

                            (The Deep Request)

 

     Thirty years ago,

I stood equatorial with high adventure –

     A young buck with prowess and skill,

Trained and tanned – and shoot to kill,

A bronze of boy with blonde of hair and,

     I thought the devil wouldn’t challenge

Me at all, wouldn’t dare strike my tall,

 

   ...

Read and leave comments (0)

Also by ZTK Space:

Cleverbridge (NHS J & H Edition) | Two Sides of the Same Coin Franked From Bulshit | The Chance They Always Lie |

Needs

One day

I will make you tea

Fluff the blankets and sheets

One day

I will build you a garden 

Plant some seeds

One day

I will take your face in my hands

One day

You will understand 

Read and leave comments (0)

Also by cosmic_bynature:

Arrhythmia | Twin Flame | Lost Letter | Technicolor |

Guilt in her pockets

Saying goodbye to hellos
she couldn’t look at the mainland as soon
as the airplane took off into the sky
leaving her wondering if things would change
after she got back home after visiting her mother
or would the wind brushing the plane
be like pressing a pause
to her emotions
of the size of the steps
she knew she would have to take
tucking her guilt in her pocket
just to say goodbye fo...

Read and leave comments (0)

Also by Andy N:

Easing out of imagination | After Isolation |

Our Earth

If there's one thing that we should love more, 
Which is there every day for us to adore,  
Around and round it has forever whirled. 
This our beautiful and natural world.

Love all of it's glorious features, 
And learn to love all living creatures. 
The plants and flowers of every colour 
Make our lives seem so much fuller.

The Sun shines down; it is always there, 
One thing that all ...

Read and leave comments (1)

Also by Stuart Vanner:

Sweet Contentment |

Stuart VannerEarthThe natural worldNature

COVID 19

 

Is mother earth trying to tell?

you, humans, made the earth a hell

Is she angry with us that we pollute?

raping the planet, always busy to loot

 

Whether COVID is man-made or not

created by politics, mistake or a BOT

We need to face the consequences of our ways

we need to take care of all life, if we want to stay

 

As we are busy writing history for books to come

...

Read and leave comments (4)

Crazy soup

Beyond logic

Beyond reason

Beyond the science of life

 

Crazy drama

Crazy rules

Crazy, crazy, crazy soup

 

Drown out truth

Drown out agenda

Drown out curiosity

 

Formed in the Pisces-ian kitchen

Flavored with the age of Aquarius

Finished with a drizzle of…

Future is yours to savor

 

 

Read and leave comments (0)

Also by Lorraine Settanni:

I know what time it is | Over | Planetary prerogative | 5-7-5 thoughts | Sourdough Bread | Stay Safe? |

Mirlees Fields

I hear the odd train passing Notice that planes are no longer the background noise The sound of birds flapping and chirping amplified Dominating the skyline once more Close eyes to listen to the rustling and swaying trees Such a cool sound indeed Butterflies bob and weave overhead Stillness unknown before Suddenly thoughts halted by the sirens that whiz by Can see a family flying a ...

Read and leave comments (0)

The Sun is out And the road is waiting

A motor

A cycle

A sicle

A pickle

I may sound fickle

I just want to ride my motorsicle

Where the rubber meets the road

Two wheels spoked

A idle heart

Set forth in accelerated  motion by the rolling rist of devotion

You have to take your soul for a ride

Occasionally hug the tank and take her to a 105

If you use the metric system

I just don't know

The idle he...

Read and leave comments (0)

Also by New Shoes:

Throw Down Your Arms |

Creativity Costs

You are enough. 

Insecurity or 

grandiose confidence 

isn’t necessary. 

Doubt, distraction, 

procrastination, fear, 

impostor syndrome,

borderline lunacy... 

are costs of the 

creative process.

Keep creating 

through it all.

But, then again,

what do I know.

https://youtu.be/sIaT8Jl2zpI

Read and leave comments (3)

Also by Vautaw:

Wildflower Wishes | Pain | Healing Muses | Luminescent Humanity |

artconfidencecreativityinsecuritymusicpoetryprocrastinationwriting

How do we do this...?

How do we do this

One day 

After another

Of same 

People

Rooms

Food 

Clothes

Conversations

When what should we have for dinner becomes

The highlight of the day

And a three mile walk becomes

The only reason to get dressed 

At all

 

How do we do this 

How long do we do this

It’s like labor 

The worst part 

Is not knowing how long 

it will l...

Read and leave comments (3)

Quarantinehomelife

spirit and sanity

Since I cannot sense a name for God

power will stutter out of my mouth

In the old days it was the Village Church

Rich with Stain Glass Hypocrisy and Sin

In the middle it was a wasteland, dead

Then I saw God and everything changed

 

Spirit stood on my shoulder and held me

Angels came in plain clothes to erase me

No-one left even though I tried to kill me

In the attire ...

Read and leave comments (4)

deathGodjourneylifeSpiritspirituality

It Started With A Cough

It started with a cough then my temperature began to rise

Finding it hard to breathe and shivers are running down my spine

It’s a deadly new virus that goes by the name of Corona Covid-19

Now the world is in lockdown unprecedented in modern time

The government says stay at home and isolate to save lives

Keep your social distance and only go out for food or exercise

Another three ...

Read and leave comments (0)

Tuesday, April 21, 2020 12:37 AM

In my hand, 

I hold my sister's spite,

my mom's frustration,

and my own anger. 

My fist is closed so you cannot see 

the contents.

 

You see raw knuckles, 

washed with vigor

under scathing hot water and harsh dish soap

until my skin succame to 

cracking and discoloration.

 

My fist is not raised.

It is draped by my side.

The weight of my hand plague eac...

Read and leave comments (0)

Also by hk:

Monday February 10, 2020 | Sunday, April 5, 2020 12:16 AM |

Our (Mis)Fortune

Your hand slips into mine, 
the fortune-teller notices 
our smiles with glittering eyes
she’s convinced 
there’s a future between us
she smiles & invites us in

Laying down cards one by one 
it reveals the betrayal and secrets
that will keep us
from the love that has swept us into a whirlwind 

We turn to each other stunned
but a laugh begins, 
she replies, “Sorry, no refunds”

Read and leave comments (0)

Also by kimberly:

Screaming Amongst The Silence | lost & found memories | just a little tenderness | Sunday Thoughts | Love Blossoms | (Un)Covering Wounds | Nightly Routine |

betrayalfortunelieslove

In the Mid Afternoon

despite the recovery 

there are still days when a hole has been ripped through my chest 

when I am drowning beneath this absence 

it is not safe to breathe 

but my body craves the humid air 

this body has grown weary and tired today 

has shifted between consciousness 

these are the days 

when I struggle still 

despite it all 

 

despite being discharged from therapy...

Read and leave comments (1)

High Tide, Low Life

You paint yourself blue, always blue
this letter brings me down
perched upon a rusty trailer
paint peels over my shoulder

I've been drinking 
since the boats were rested
on the muddy estuary bed

It's high tide, low life
high tide, low life

I won't stop my reaching out
if there's any way to help, I'll find it
you're so slow to take my hand
scratching at your skin for answers

I ...

Read and leave comments (1)

Also by Tom:

Harm's Arms | The Essay | Bonfires |

depressionfriendshiphelploneliness

and yet there is 

and yet there is 
another day 
when I feel blessed 
to breathe 
to live 
and to love

what a gift

I stumble out of bed 
and find myself 
amongst life 
my fears have become 
almost invisible 
my curiosity enormous 
the will to find out 
to explore 
and to capture 
something significant

Read and leave comments (0)

couragelifecuriosity

Together

I wish there were words for how much I love you 

I wish there was something I could write 

its not a sentence or an essay or a poem

it’s a feeling and a closeness I can’t live without 

it’s days and days of trying to grow together while learning to understand ourselves 

it’s the time we spent apart and how fake and wrong it all was 

but there you were

with your beautiful eyes ...

Read and leave comments (0)

Also by Robbie Christian:

LSD | State of the Union | Robbery | The Most Meaningful Poem Ever | The Eternal Lie |

fingers through my hair

You ran your hands through my hair

As we listened to the “feel good” music

We laid there

together

Hoping to lay there forever

But in an instant

Forever is never

Like a black hole

The feelings were sucked up

Into another dimension

For different relationships

Except the memory of that night

The one that I can never forget

As we looked at the stars

Running yo...

Read and leave comments (1)

In the garden

I am angry with you,
My Lord, today.
For you have taken
my love away.

Taken away,
Before we could live.
You took,
When you could give.

All alone, 
My love can't grow.
My lovers touch,
Never again to know.

We believed in you,
to the brim.
We were the flowers,
You our stem.

Now in the garden,
The garden of lo e.
By the will,
Of you up above.

One small petal,
falls from...

Read and leave comments (0)

Touch The Universe

direct your gaze skyward.

I see your eyes slip through

lens and the light shoot down,

orbit in your twitching

left to right,

left to right

panning light in soft night,

oxymoron of telescope

gathers perception -your feet-

fall here and your stare there

pinned to the pit of ground,

grate your phrase from fireplace.

and divide.

put syllables in pen,

cross out...

Read and leave comments (0)

Also by Hannnah:

Redemption in the Water | Some Distance with No Distance | Desire | Something | The Epitome | The Pretender |

liberationpoemsself criticalcomparisonfreedom of poemsmetaphors

Grandfather

He was tall and strong, 

Didn’t say much, just watched.

I would climb up the trees to get mangos,

As he would watch.

I would fall and he would watch.

I would wait for my share of those juicy fruits,

Yet I would never get any.

Being the smallest I would cry,

Then he would call me.

Taking me to his secret stash,

And letting me pick as many as I pleased.

He would then...

Read and leave comments (0)

Also by Ira Chaturvedi:

Facade |

lovedones

Corona-Regime

A World War is declared
by the smallest living beings
against the smartest of the creation
while all others wars have stopped.
At least for the time being...
The weapon race is ceased
No missiles are fired
No suicide bombers in action these days
No mosques or churches demolished any more
All warriors have reverted back to their shells
(how brave)
The sceptre of the mighty creature has t...

Read and leave comments (1)

Unholy Boss

Unholy Boss

It was during the Pandemic of 2020,
when I heard a boss chewing out a worker.
“You’ve been coming in late…Lately”
“You check your phone too much, buddy”
“You drag your feet too much, after lunch.”
“You take too long when you get the stuff.”
“Your attitude has been terrible, man.”
“And that’s why I have to make rules for everyone.”

He says this while working during a shut d...

Read and leave comments (3)

Also by Chris Bunton:

Scary Things | Nature's Breath | House of Giants | Conspiracy Theorist | Days of Old |

Spoken Word poetrysocial justiceworking class menfreedom

Evidence

Advertised everywhere

No chance for it to be ignored

The blaring signals and sirens

Please don't use the excuse that you're bored

 

The excuses and reasons don't work

Not anymore

We've endured the lies but now

You even deceived the law

 

You did not leave out of choice

You were removed

Lying to yourself and to others

You seem confused

 

The rules apply ...

Read and leave comments (0)

Also by Beth Abbott:

17 and a half | Genetics | Rhetorical Question | Blank Paper | Acknowledgments |

covid19coronavirusdeceptionblameMaturity

THANK YOU NHS

Thank you NHS
- - - - - - - - - - - - - - - - - - 

Thank you for the hours you spend
Fixing bodies to help us defend.


Thank you for shielding us  so safe;
From Corona's wild and wicked wraith.

Thank you for fighting this world war;
We will, we must find Corona's flaw 


Thank you for your tireless work; 
courage in duties you never shirk. 


Thank you for your sweet smile of ...

Read and leave comments (0)

Time to learn

You can grow a lot,

you can change some rules.

Or modify as per your taste.

But you can not exceed your own shadow.

Nature bounces back.

Its time to learn again the alphabets,

to bow and to surrender.

Read and leave comments (1)

Darkness will turn down today

Emptiness now seems to weigh,
Stubbornness now waits at bay,
Abruptness now gives a way,
Darkness will now turn to day..

Brightness soon looks to grey,
Firmness soon falls to prey,
Correctness soon starts to sway,
Darkness will now turn to day..

Busyness would light the hay,
Craziness would start its play,
Promptness would go away,
Darkness will now turn to day..

But

Braveness...

Read and leave comments (0)

Current TimesLifePoetrypositivity

...Mosca And Bees...

Love is a mosca biting the aorta.

I clutch my chest to qualm the swarm of egregious sting, translating into certain sentences.

There is nothing to say when you bite the fruit, when the soul is in ravenous hunger...Why not wait until I rot?

 

My soul will always be old...

 

Days of everything from spectrums and orbits. Nights without use of the eyes... My extinguished love affair ...

Read and leave comments (0)

Lovepoetry

The Intrusion

The Intrusion

 

Juxtaposed with the dutiful arrival of Spring

bringing garlands of heavenly bouquets

We slumber in a permanent fear

of a plague whose rampant character

lies beyond the control of any man

Forget me nots bloom in the shade of a tree

daisies and dandelions grow wild in the fields

Hastily constructed hospitals await the infected

mortuaries receive unpreced...

Read and leave comments (11)

Also by keith jeffries:

The Hedge of the World | A Painting | Sea Fever | A Tenuous Existence |

Lifetime without you

It doesn't get easier, it never will 

You are gone and the world is remaining still 

All those happy memories even bad ones,  i will hold close

My heart is shattered, my best friend doesn't have a pulse. 

There's so much i want to tell you, so much you need to hear  

The fact that im alone again is enough to trigger the fear

But, i know you would say be strong he doesn't deserve ...

Read and leave comments (1)

Also by Stacy Eskin:

The unanswered question |

Some 20 little steps away

The Night we sleep and the day goes by
Until the next dawn
Nature is what we all have
The mighty sun, the gleamy moon
The shimmering light of the thousands stars
Oh all we see is our mother
Nurturing us with a touch
So intangible 
No art can express.
Oh I wish I was still there
When I was too young to know
Creeping down the ground
Gazing all what was around
With a mysterious smile
Th...

Read and leave comments (0)

Also by Kritarth Jaiswal:

Somewhere |

Angels In soiled Scrubs

angels in soiled scrubs

doing battle for our lives

barely time for tears

Read and leave comments (2)

Also by Trevor Alexander:

Freedom |

Senryu

A ROUGH DIAMOND

A ROUGH DIAMOND
(For Norman Hunter 1943-2020)

His name always evokes a smile
On the faces of footballers
Schooled on the uneven battlefields
Of a different era.

Days of the enthusiastic header,
Demolition shoulder,
Iron obstruction
And scything tackle.

Even those who carry no torch
For Leeds United or England
Today nod in respect
For a player who did as asked

And fulfilled hi...

Read and leave comments (2)

Welsh Poets.David Subacchifootball

All His Geese Are Swans

 

 

All His Geese Are Swans

 

All his geese are swans

I said all his geese are swans

If I’ve been to Tenerife

He’s been to Eleven…erife

So don’t even mention La Mans

Cos all his geese are swans

 

 

If I give it large

He’ll give it one bigger

Said his wife was a film-star

She looks like one…. Trigger

She wears Tiffany Earrings

And yellow zircons

...

Read and leave comments (4)

Also by kJ Walker:

All His Geese Are Swans |

Suicide

"you didn't even know him well"

"You don't have the right to cry"

Suicide.

"But he is still a person"

"My emotions are relevant to me"

Suicide.

"He had no reason to be sad"

" Why did he end his life"

Suicide.

"We would not know that"

"I guess for him it ended a long time ago"

Suicide.

"Zoe stop,only his family should be sad"

But they don't know I'm also sad b...

Read and leave comments (0)

Also by Zoëlla:

Where am I? |

The Night

THE NIGHT

The night, that dark and rancid cloak,

contains within its half-drawn claws

a certainty I cannot match,

nor merely approach; my fear prevents

such posturing.

 

Darkness wants for nothing,

save my peerless pride

that so often burns down to hubris

and faithless self-promises

written distractedly in flowing water.

 

Now I rarely leave my house

(the ...

Read and leave comments (0)

Confessions of "A" RaVeN

I pull away to face the pain,
For fear that I will never find a way to heal my soul again, 
with the torment from the memories of better days,
As I get lost in a waking dream, I pull away to face myself,
Cause when I look into the mirror I see the reason why you're gone.
With only myself to blame,
How can I face my own shame? 
Letting you in and showing you my tainted soul, I told you that ...

Read and leave comments (0)

Also by RaVeN Mathews )0(:

Confessions from A Wonderland - At the Edge of All Things |

Mirror

The mirror in the room

holds me quite tightly

within its glassy memory.

Standing aside from its stare

I know what its thoughts are.

Dreaming of a reflection,

reflecting on a dream.

Still, but still in motion,

an opposite movement

a trick of the eye,

thoughts backward,

it emulates itself,

and echoes all before it.

Patiently waiting for its time

to cast a li...

Read and leave comments (2)

mirror

Vra Vra Vroom

 

I lost my vra vra vroom

The day you got your diagnosis

Felt joint tomorrows wither

With the growth of what we knew

You – with your mother’s heart

And dragon’s roar

Saving me from lions

Or bullies, or bees...

My sister, my confidante,

My best friend

 

Entombed within the capsule

Of your hypobaric oxygen chamber

I stand outside and count the miles

Fear ...

Read and leave comments (4)

cancerhopelove

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

Also by Shawn Garcia:

Illumination |

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac

Fingers Crossed

Fingers Crossed

 

Hope for the best, but prepare for the worst,

By this natural quirk our future is cursed.

Keep on keeping on and show your best side,

Together we’ll one day have parties outside.

 

We hide in our prison cells, watching tv,

The birds in our garden, the buds on the tree,

Our freedoms so precious now need to be lost,

As we sit here in fear, our fingers ...

Read and leave comments (1)

Also by mike booth:

Kicks with Joe |

Poems are not for happy days

Poems are not for happy days,

For resolutions and self-promises,

For being tough and unresponsive,

Poems are not for new beginnings.

Poems are searching, searing, morbid,

They turn you in and leave the sun,

Poems seek out your obsessions,

They tickle them, they wrap them in a bow.

Poems are not for going out and doing,

For being your great mechanical self.

Poems preve...

Read and leave comments (2)

poetryhopeselfinwardness

New ways

Effervescent days

Dissolved into space

Awaiting resolve

The old way erased

Hibernating humans

Watch nature

Run free

A reversal of roles

A new way to be

Read and leave comments (3)

new world

North & South Published in Litro

...my story is on the front page of http://www.litro.co.uk

...published on the 11th April, and called North & South.  That's good, innit?  I'm on a roll what with BBC Radio York the other month.  Bad timing :/. xx 

Read and leave comments (0)

LitroNorth & Southpublished

Around the corner

I will go on with my life, 

like I would never know you. 

Like I did before we met,

when I didn't know you. 

I was careless, I was free, 

not realizing round the corner, 

something is waiting for me. 

There was you. There were nice things. 

Now it is over and I go on, 

looking for a new corner to come. By. 

Read and leave comments (0)

Lockdown

maybe it’s natures way of telling us

to slow down to reset a bit to take stock, 

to turn inward and then outward 

in kindness and support

 

maybe I’m just saying it’s a good thing 

in the long run, a reassessment of sorts.

 

weeks ago who would have imagined 

an ethical Tory, clear skies over Beijing 

who could’ve have foreseen the sacrifice 

we are to make for the...

Read and leave comments (0)

Corona virus

What's up with Steven?

What’s up with Steven?

 

spends all period on his phone

generally polite 

will get a worksheet done 

 

but then wants 

to sit at the desk

or start a fight with Kenny or Ishar 

 

has this faraway 

look in his eyes

too heavy for someone that young  

 

I know there’s nothing ostensively  

wrong

and you’ve talked to his mom 

 

so just endure him fo...

Read and leave comments (0)

Also by Robert C Gaulke:

on passing through the deathtollbooth | ourselves | The Night Calls |

Gift of my life

Meeting you once and for all

Sensing the smile 

Feeling the beauty hidden deep within 

Paused me for a while

My heart dreamt only because of you

For you the greatest gift of my life

 

Caring and the sweetness that I seem to find 

When I see you in front of my eyes

I feel my dreams becoming my reality 

I never wish to die

For the gift of my life is you

It is you ...

Read and leave comments (0)

It Doesn't Matter Anyway

It doesn’t matter anyway

That something went unseen today.

Everything fades away.

 

It doesn’t matter anyway

That coastal waters washed away

Our footprints in the sandy bay

That yesterday the sun was warm

And the boy next door played on the lawn

 

It doesn’t matter anyway

That much to my dismay

My bicycle was stolen whilst I was away

And last night our neighb...

Read and leave comments (3)

life

A Walk in the Clouds

Take a walk amongst the clouds

Then slowly lose your way

Float freely there in weightlessness

Then drift far away

Ride aloft upon the wind

Let yourself be taken

Mix and morph and be reshaped

Disperse and reawaken

Observe the sunlight shining through

Each vapor drop a prism

Tiny vibrant rainbow orbs

The beauty of true synergism

Allow yourself the luxury

To vis...

Read and leave comments (1)

Also by Lisa C Bassignani:

FUBAR Friday | A Story...II |

Nothing but rainbows

The lights are still on

But there is no one there to see them

The traffic lights wink at each other

In perfect sequence

Saying its your turn now

But not a single word is spoken

Because there is no one to speak them

And no one to answer back

No jugglers

No singers

No speakers of the words

No hawkers

Crocodiles of children or foreign tourists

Just the stand st...

Read and leave comments (8)

2020 Spring

Poetry, written by Ali Taha Alnobani

 

A metallic alien object with plastic gaze

Without emotions, and no feelings

It holds tapered forceps and a magnifying glass

It runs on the empty street

Like a spooky ghost

Like an absurd robot

His eyes are round, red

His nose is crunchy squared

And his voice is like air when it comes from the hole of a sick object

***

Now h...

Read and leave comments (1)

Corona virusDeath by Virusreal life storiesdream of freedomfreedom anywherefreedomspeakopendoors

In a Valley of Many Ash Trees

In a Village of Many Ash Trees

 

Palm Sunday 2014

the clock of St. Leonard will tell only

one time. Two minutes to eight.

 

It’s four-thirty,

a shattered sunlight catches on

gravestones, hides names from view,

 

keeps the late of this parish, secret;

causes you to struggle as you read their fate

in polished marble or mis-placed lead letters.

 

Sad tales of...

Read and leave comments (3)

EasterGood FridayMonyash

Broken Heart

What do you do when the person that once brought you love brings you nothing but pain.

What do you do when the person you gave your heart too took it and threw it away. 

What do you do when your heart beats so fast it feels like it is coming out of your chest.

And the love you once had starts to change into tears and hate.

And that person that once brought you comfort and made you feel...

Read and leave comments (0)

Also by Jacqueline L Elias:

Empty |

Broken heartsadnessgod loves allfaithhearthealinglove poetry

h e r

this world is a universe

for she is a world 

in herself

at every turn beautiful;

a billion flowers 

in any garden of gloom

would bloom to her smile;

her existence is life

her instance pride

with sadness shied away

the swooned heart

travels miles in a beat; 

every sweet smell 

reminds me of her

the earthy perfume

rain sends forth

the flavored whiff 

...

Read and leave comments (0)

Also by Nitya Swaruba:

d i s s o l v e d | deprived? | pity flower | coffee and me | the send-off |

womangirllovesweetbeautymemories

Coronar's Invasion

The creator that i am,

the creator and the creator I am the creator of that,Corona and that creator, Lord, give us a little compassion If you punish God we are your servants If you forgive, you are the Almighty You drove us from your mosque You have taken away all our good living ties Now there is nowhere else to shave hands and nibble Everyone is far from everyone How angry you are, Lord, to u...

Read and leave comments (0)

Also by Md Abdul Hannan:

Oma'Homland | (untitled) | Raps vs our world |

Petitions to God

Daydream

Erebus puts his arms around me and hugs me close and tight

    All my troubles melt away in the suns bright, warming light

The heat upon my freckled face inspires an unhindered smile

    and I can stay in breeze and birdsong, I'll sit here for a while. 

My eyelids close, my mind opens and images start to play

    of mountains, fields, treks and climbs, long fulfilling days. 

Oh h...

Read and leave comments (0)

Also by SophieJPugsley:

The Hermit | The Warrior | Elemental | Into the Wild | The Overland Launch | I know you, Love. |

The Hermit

The hermit lives alone

No computer, no internet, no phone

He lives up there in his wood

Having left the city for good

Long ago when things were new

And his dislike of society grew

His wife was gone

His kids moved on

And so the hermit went

To his wood where he has spent

Day after day

Building in his way

A place not only to survive

But also to thrive

For bei...

Read and leave comments (1)

Also by josh:

The One Who Got Away | The Flower |

Hi All

I have written something which I hope is uplifting, and a silly haiku. They're attached. Hope you like them!

A Gift

 

I have a word to say to you

to bless, and to uplift.

There is no charge for what I say,

because it is a gift.

 

When hard times come, and come they will,

and right now springs to mind,

my heavenly Father waits for you,

His ear to you incli...

Read and leave comments (0)

Soldier Les And His Mighty Fez

The following is an extract from a torn and battered journal,
made by private MacPherson, renowned as a poet, of the Shropshire light Infantry

Corporal Lesley Loveday, known to his mates as Laughing Lez,
had such a reputation when in service of the British Army, he was allowed to wear a fez.

He bought it from a native in a house of ill repute,
who claimed it was blessed by Allah, a claim ...

Read and leave comments (0)

Nobody's Fool

I am not the same 
as I was yesterday
For I have grown in knowledge
I have learnt something new
I am nobody's fool

I am not ashamed
of the choices I have made
They were made for survival
People were so cruel
I am nobody's fool

I am not afraid
to ask the hard questions
To get to the truth
To search for clues
I am nobody's fool!

 

 

Read and leave comments (0)

Coming Home After an Exile in Marriage

Coming Home After an Exile in Marriage

 

My mother cried when the passport man smiled at her.

Welcome home:

Two words to bridge an ocean of grief,

Three syllables to encircle her fingers,

Kiss her lips sweetly,

Cling to her clothes like the smell of English rain-

Hold her.

Just as the tarmac cradled her feet as she rocked back and forth, still at sea-

But home.

Six...

Read and leave comments (4)

Just letting words flow

Into the depths I go, searching,

Just trying to find any piece

Of the soul I am missing

So I can find my release

And be free of these chains

That bind me to my circumstance

I'll free myself and run away

From this disaster if I get the chance

Leave me to die out in the wilderness

And I'll find a way to survive

Because I've gotten real good at

Escaping my fate, stron...

Read and leave comments (0)

I'm sorry.

Broken

It’s a weird feeling. 

Hating yourself.  

Always. 

I try so hard to put on a show

Always

To all of my friends

And my family 

I need to be strong.

I don't want pity 

I don't want to be a charity case

I’ve always been the person people come to for advice 

And I’ve always been there for all my friends 

And goddammit, I wish they were there for me 

I me...

Read and leave comments (0)

sad poemssadsadnessdepressionlifestrugglehelptiredweakness

Clearly Connected

Connected

 

You went for a walk 

What was that you say

I feel I hear you no matter how 

Near or  far away

It’s like you are

Resting on a bed wild flowers

In my brain

Clearly as a waterfall falling

Clearly las the green that spring brings

Clearly as a full plate of health for the healing

Clearly we are connected 

For a reason 

 

Read and leave comments (0)

Also by Cameron Williams:

Is it wrong | Connected |

Celestial Moon 7/4/20

Sitting under this light,
I conversate with my soul, to seek a better truth.
This cigarette smokes swirling over me,
But I must say, what a beautiful view.

I can't help but deny, this beauty over me.
Nothing shining brighter than this, not even the nothern star.
A smile creeps up on me, in awe of this light.
I think of something I've known, all along.

This moon must be jealous though,
...

Read and leave comments (0)

An Antediluvian Rhyme

"There are pandas in the parlour,
   There are spiders in the sink,
There are polecats in the pantry,
   And a terrifying stink;
There are wombats in the wardrobe,
   There are penguins in the bath,
There are monkeys in the shower
   And they look at me and laugh.

"There are cheetahs in the study,
    There are dodos on the stairs,
There are rhinos on the landing
    And a pair of pol...

Read and leave comments (4)

Dedication

Here's to Soul- the delicate and dreamer
Here's to Body- the Intelligent and forgiving
Here's to Tear- the vast and nourishing
Here's to Heart- the constant and wise
Here's to Eyeball- the beauteous believer
Here's to Palm- the giver
Here's to Nose- the blind sear
Here's to Lips- the traitorous sugary Sirens
Here's to Tongue- the advocate of Brain and Ear
Here's to Ear- open minded though...

Read and leave comments (2)

Also by Mae Foreman:

Identity-A Tautacrostic | Resented Read | Torrid Stellar Time | Wish Upon A Pen | A Cynic's Prayer | Deliver- A Tautacrostic | I Strode Sure- A Tautacrostic | Last Pommegranate | Aesthetic Rapture | Harrowing Hurricanes In Chains | Plague | My Name | Aquatic Lucidity | Marry My Havoc |

Better alone by Atile (the bread queen)

When I’m not alone 
All I do is moan
I also groan
My companions say “Oh won’t you stop!”
But my only reply is “I’m going to the shop”
 

 
When I’m alone
I can play my trombone
Without somebody screaming “I would rather you moan!”
And I don’t always have to go to the shop
I just always watch TV non-stop
 

Once I was alone
And I was on my phone 
And I was shown 
A warning about a...

Read and leave comments (0)

aloneconfinementcovid19

Sun's Tease

Sun is teasing me,

Making its way through…

 

Cracks in the cloud,

Gaps between buildings.

As if it’s not allowed

To give all that it’s yielding

 

Yet still it finds me,

For just a few beats…

 

Over roofs, on my brow,

A little hope it can shed

Not for long but just now,

Warms the corner of the bed.

Read and leave comments (0)

Palm Sunday

I lately watched your video, a Palm Sunday morning show of you and your wife.

Me, your mistress, now ashes of passionate fires, forbidden fires.

Intention of sin in your ideology.

And then this scene of an innoscent couple, the ones who try to pretent what they aren't.

More on:

https://cms.e.jimdo.com/app/cms/preview/index/pageId/2140842394?public=https://magicalwhispers.jimdofree.c...

Read and leave comments (0)

Also by Magical Whispers:

Fill me. |

priestchurchmistresspastorpassionpalmsundaymemoriesforbiddentraditions

There, there

My daughter tells me she’s picking up
more shifts than she normally would.
Her hands are raw and she’s running
out of sanitizer. I know she doesn’t
expect anyone to fix it but still I check
the expiry date of my aqueous cream.
Later, I place the tub in the garden
and watch over it from the window.
When she finally arrives she orders
me back inside. This time a hug
isn’t going to make thi...

Read and leave comments (2)

Sick dog

I’m a sick dog
with high bark hot tongue
matted fur not long
leave alone.
Grr grr

Read and leave comments (0)

there'll be four and twenty guys

Now, the world is very wide
(seven seas from side to side)
and it holds a million ways to tell a tale,

And you'll broaden your horizon
When the work you lay your eyes on
Isn't always European, straight, and male.

If you've ever been and gone
to a panel at a con
I'm assuming you're familiar with the sight:

There'll be four and twenty guys
Who are listed for the prize
And EVERY SING...

Read and leave comments (0)

LA CONCHA

LA CONCHA

The bank robber is a gentleman

raising a towel for his love to dress.

I wake some way down seashell beach

while Rick still snores behind me.

 

Bags rolled tight, we enter a bar,

slump on stools in a line, all four

staring at our reflections in the long

mirror behind the steel counter.

 

Jesus spreads arms wide over the bay

and we are down to out last p...

Read and leave comments (8)

nevernow

here in prehistory the silence grinds

like a second star
in the gold light of Saturn
breaming tongues of fire
on the cold broil of the brain

skulled-in squarely a flickering husk
and there go the dreams like mosquitos
to the cranial grave
shew your voice against that hush
with faultless animal empathy
curse your ghosts to a pyre of peace
in 4D purgatory
eviscerate the simulation
w...

Read and leave comments (0)

Also by Kealan Coady:

Thereafter |

Words

Your words cut right through me.
Your actions pound through my skin.
My heart beats to the sound of melancholy,
When you say those words to me.

Cold shivers run down my spine
As you throw biting words right at me.
You tie me up in grief and pain
And I always fail to escape.

I walk through a valley of emptiness,
Each day getting closer to ultimate frailty.
You take away my glee
Now I...

Read and leave comments (0)

Black

Her soul is black
I can't touch it
If I do
My heart will melt
And turn in to stone
So know I wonder
How to undo it?
If I can't even recall
How I feel it
So much intension
No execution
So much passion
No inceptions
Then I promise
To turn that in to white
And make it bright
To see and to feel
All that grace
And make my self gaze
On what I see
And what could I have
Merely
But so...

Read and leave comments (0)

Isolation

 

Four walls

Little comfort

Self control, the rage inside

Missing choices
Voices taken
Expelled forsaken
No choice
To live..
To feed the fallen
Four walls
One door
No comfort,
challenges acceptance
we shall over come

Read and leave comments (0)

Also by Anna Marie Grinter:

Repulsed | Mother Nature Darkness Is Calling | A Haunting Fantasy | Demons | Bliss | Just Words | Silent Tones Of Unearthly Souls | The Narcissist | So Close | A Dance Without Music | Isolation | (untitled) | The Burning Of Man | We May Be Weak |

isolationLifeRealcaptivealonelonely

All the world’s ablaze

All the world's ablaze,

Ravaged with unruly plague,

Ancient mother’s wrath,

Tearing us from familiar path,

The gouging towers, concrete skies,

Crumble before our summertime eyes,

Gilded in a nation’s tomb,

All the same from grave to womb,

But hope is a hunger, we must feed,

And courage tends to flourish in hours of need,

For we must scale icy peak,

Although all loo...

Read and leave comments (0)

World silence

 

If we had been told the tale
Of the coming of  the August
Visitor that has paid the
Whole universe a visit,
We would have rejected the visit..


The March of the double “20
Has left the world speechless
With the influx of the  change 
In the program of events
We are used to living..

The world is now at war
With the pandemic disease
That has snatched out rights
To live and lov...

Read and leave comments (2)

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message