Aethereal protégée

Universal consciousness is omnipresent
— living vicariously, we too are one - and the same,
Having the time of our lives
all knowing— enlightened divine sparks
going —Godspeed.

This is a way of life:

Anatomic amino acid building blocks chain letters,
into the complex double helix;
in our initials is a chemical signature—me and my significant other have between us—
this bond, that

Read and leave comments (0)


Illustrious Demiurge

Once in a blue moon and many light years ago,
Otherworldly starseeds began to incarnate,
and add to the menageries of the Milky Way's sacral space

in-between you and I: What a “sui generis”-jagged siamese
piece of a memory
with our other half
—filling us in—
on where we’ve been our whole life

So as to make known, any preconceived notion; shown in its true light, and meant to be…the des...

Read and leave comments (0)


The Coming of a New Age

With every year's end - the advent marks the start of a new day,
as human kind we’re always growing wiser, furthermore, fully face to face with the task of taking baby steps toward a straight forward path —
It’s time to take a stand…
(With that being said: we really need to enjoy such a joyous occasion)
In an effort to boost morale; International Women’s Day should pronounce a two part holiday...

Read and leave comments (0)

Naturefeminismfashionspiritualitygodlovepoempoetrylove poemspiritualmetaphysicsmetaphysical poetrymetaphysical

I Love Your Allure

I would never question your narrative— as it be, figuratively.

Cheers to another year: it’s ever clear — our glasses never get drunk.

(for all intents and purposes) spirited twin flames pour out libations to a personal god
No half truths with you.
I idolize your third eyes outlook on life...
Our inner visions - seen to fruition - showcase infinite possibilities
Granted we share the same ...

Read and leave comments (0)

NaturepoetryspiritualityValentinesloveloversromanticromantic poetrygodcreativeastrologyastronomypaperromancecreation


Entering into today’s day and age, we take turns turning the page.

Let us begin,
as were taken back to a time— lined with the new heights of always measuring up to ones expectations.
Ascendant signs are all "GO".
birthmarks placed on the face of the earth; add attachment to the earthly plane, and embody rebirth.
the fabric of the universe tucks us away—as our materialization is made—from a ...

Read and leave comments (0)



Hello, how are you today: upper,middle,lower— class.
front, and center.
I’d like to think if a kid were to get up and say I can’t stand this, then the teacher would get behind them in an orderly fashion.
side by side, classroom C-3 parts in the middle of the day, to make their way back to their seat,
show and tells of mommy and me– are always well received.

A pinned-up faction icon that sta...

Read and leave comments (0)

alignmentcrushearthgeometrygodhollywoodhoroscopeslovelovedloversnaturepoempoetrysacredspiritualityValentinesvalentines dayzodiac

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac


occult curriculum, whispers of the ancients, leave for letting out secrets
oil lamp kindling catching flames; shining begotten light from passerbys
in between classes, shifting penrose stairs lead into underlying framework on occasion
halls lined with rooks adjacent and curators searching for a select
rites of secret passageways proclaimed, karma to the dark is just a means to an end
time and...

Read and leave comments (0)

beautygodilluminationlightlovelove poemsmetaphysicalmetaphysicsmusicnaturepoempoemspoetrysciencesoundspiritualspirituality

Astral Breadth

A trestle table set with content and classical elements
places a coven with arenose intent in a safe space
their minds set on causing change—present occurences canvass Mandala by way of effect.
fascicle circuits blitz and singe might-have-beens
washing away strands emblazoned in ever apparentness
accommodating silver lining fringe wherein proper golden ratio leaves
their genus' plant matter ...

Read and leave comments (0)

astralchangelovemandelametaphysicsnaturepoempoemspositivityspiritualitywomen's day

spirit assortment

Shining ever so bright
a beacon of hope, like a chinese lantern
photosynthesis get' me through the night
beauty so divine, i wonder if i could map her
would the geometry show me the light?
because she must be god's best work

my third eye look through the peephole
how can she not have walls up when she deals with these people
guide me, be my mentor
would you take my hand, and put this fl...

Read and leave comments (1)

lovelove poemlove poemsmetaphysicalmetaphysicsOasispoemspiritualitywater

splendid resplendence

in your essence I sense resplendence
could do no wrong by me, your personably impressioned defendant
your honor is what I strive for
it's why the day turns to night, sun and moon argue back and forth
fight about what's wrong and who's right, tug of war
light bends but doesn't break, shines through the prism, and is perceived in different waves

I met you once but my memory is starting to fa...

Read and leave comments (0)

dayLovelove poemlove poemsmoonnaturepoempoemsspiritualspiritualitysun


rigorous exercise, training my mind
the center of my world, I give you my due diligence
love to watch me write by candle light, would you guide my hand and evoke my true penmanship

law of attraction, I cast it out, and ask around
I question myself, then take affirmative action
groundbreaking truths shatter walls, somebody hand me my protractor
searching the sea floor and tapping the well d...

Read and leave comments (0)

Battlefieldfemininefeminismlovelove poemlove poemsmatriarchnaturepoetryscrying



Matriarch butterfly, conduct conducive
mother gaia's demeanor echo.
as you move mountains

as she size your shoe, electrifying presence
you're so well grounded
heart fluttering, don't be disheartened.
trumpets erupting, as you walk the walk, my mind carry off as I'm wrapped in your minutiae

Shift the world, your tectonic occupancy lay rise to volumes of topographic novelties

Read and leave comments (0)

Matriarchlove poemloverslovelove poemsspiritualitynatureearthmetaphysicalmetaphysics

Chalk Initials

Love is in the air forecasters say
at first blush, be that as it may
chalk initials in handpicked tins invoke remembrance by paving ways
palms supine scribed with written in lines tie sanskrit signs
significance is found in the now
springs and gears ticking time
as faeries grant blessings shifting through a lovers parade

Concurrent reminiscence written on akashic pages taking turn
Books ...

Read and leave comments (0)

love poetryloverslovelove poemsspiritualityValentinesvalentines dayValentine poem

prismatic beings

legs crossed i lay, deep in prayer

as i enter her domicile pyramid prism with a rainbow flash

headspace filled with subsequent intrinsic peace and peachy afterglow, washing out wrath

sifting through the banks of her mind, i produce schisms, and visually metaphysical visions

visualization techniques split at the ream leaving a colorful flurry

scurrying across triangular entropy into ...

Read and leave comments (0)

New Age Spiritualityspiritualitynaturemotherlovelifepoetrypoemrelationshipshappiness

second wind

My vitality feels resuscitated with every breathe we share

two halves of a heart

you are the oxygen that pumps, vestibule, pair of consonance heartbeats

bounce off the walls.

we jump up and down hand in hand

your touch warms through and lights a fire inside and around

sound mind when your whisper incites a riot

the night is charged, god particles in the air.

our souls dance...

Read and leave comments (0)

beautybreathehappinesslifelovelove makingnaturepoempoetryrelationshipsspiritualspirituality


Tranquility in your presents

doves pecking as our kiss is tending

lips lock our mind in a spell, as the doves sing their song, letters spelling in the air.

clouds draw me close for a better look

fractals in the nooks, lump to lump, baby rainbows extend their hand and shake with glee

telling my lover she is the best mother to be


She see's the beauty in my beastial nature, cal...

Read and leave comments (1)


soul mates

Let's let our thoughts tango and let our souls mate

my heart on my sleeve, on display

she is my armor, forever with fervor

worth the search for, pain couldn't hurt more

Her radiance blazes, visually a spectacle

her calming presence.

In essence, my mind linger.

Drift off to the cosmos. to a place where space and time coincide

I see her constellation and engage, warp drive


Read and leave comments (0)

naturespiritualitylove makingspiritual bondshapelessspiritualpoetryearthPainlove

Drawn together

Drawn together, by god's hand
canvas weathered, with black clouds on foreign land
placed on parchment in the darkness
the line is thin from me to you, each other's mind paint the others dreamscape

drawn to you, the flip book of life brings us ever closer as every moment pass
each page bookmarked and in immediate view, I pray always my spine hold from the load placed on you
on the margin ...

Read and leave comments (0)


Walls fall

Seismic vibes reach through the faults

the connection pulls us together collectively

As we embrace, we look for a way to drown out our doubts and fears


Walls fall, curled up under the table, her past remains the same

as for her future i can save her, let us recover

what was lost to damage.


Sift through the rubble for our gems and jewels, trinkets and fuel

as we lie i...

Read and leave comments (0)


I strive to be a part of the hive

The queen bee is the light of my eye, the spark of spark divine.

Her frequency speaks to me, peacefully, decency well balanced in her machinery

I drone out the static, feel the hum of her words

I strive to be part of the hive, so what's mine is hers


I step out to amass my bouqet prize 

by her side, in line we all move in unison but i see her eyes meet mine, and they drag my min...

Read and leave comments (1)


Atypical ascension

Roses in bloom as i scale the stairs from my tomb

I've been away a long time,but the sweet scent of morning dew brings me closer to you


Felt like the fall from heaven was endless

but our hands met when you picked me up, foreign land for both of us but you never lost your gentle touch


I wake up and send praise to the gods, the woman of my dreams persists into my arms 

she p...

Read and leave comments (0)


This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message