fantasy (Remove filter)

Follow your fate

Follow your fate like it's a mystical path of promising wit; follow your dreams like they're a reality in a captivating fantasy.

Read and leave comments (0)

🌷(1)

mysticaldreamsFantasy

How

Neither could it express, nor could my heart contain 

Now, if I dare to speak, how do I start ?

In the daylight, my heart goes insane 

Please tell me, how do I reveal the mystery of my heart .

 

 

Read and leave comments (0)

🌷(5)

lovefantasy

The Beast Beneath The Beck [song version]

The Beast Beneath The Beck

 

The beck at Westgate End is full of reeds,

its water is a muddy shade of brown,

confused ducks die within anaemic weeds

as sunken shopping trolleys pull them down.

Sometimes you hear a cold slithering splash,

as though some ancient creature has slid in

to feast upon the centuries of trash.

Who knows what evils are contained within?

 

It...

Read and leave comments (1)

🌷(7)

wachfeldwakefieldbeckwestgatefantasyalcoholism

The Grand: Act 1: The Curse of Skye

***WARNING*** the following content contains themes of self-harm and may be sensitive to some audiences. The content below is not deemed suitable for children.

 

***the content below is an excerpt and lacks context. Read at your own discretion***
 

V.01 "raw from author" edit. 
 

The scene was a collapse of the mind. It was no fit of rage, or some unfounded self-torture; the boy had ...

Read and leave comments (0)

🌷(4)

loveromantic distance love dan hooksfamily poemFantasyfictionself harmromanceLove Art Sketching Doodling Romancechir jam speakeay wordsmiths poetry expression artdan hooks poet poetry alienpoetHaiku World Cupfantasy poemsscience fiction

On Henrietta Street

The children howl, the house is hell
you close your eyes to cast that spell

Rising high above the endless squabbles 
to meet me down upon those sodden cobbles

The rain and fog are gently taunting
your white shirt billows, opaque and haunting

On Henrietta Street…

Two hundred stairs, do I descend
with full-beam smile to my treasured friend

These precious moments, we get to steal
...

Read and leave comments (2)

🌷(5)

escapeadulthoodresponsibilityloversfantasywhitbycoast

Doctors

 

I used to see them as a boy:

Hanging around on street corners,

Loitering with intent,

Picking off the ice cream vans, one by one.

They pandered to the masses,

Displayed all their wares:

Scalpels, sedatives and inexpensive love.

They were the last resort, the leaky policy,

The get-out-of-jail card, for one more week.

Two for the price of one, sometimes.

‘Lie down...

Read and leave comments (7)

Fantasy

BLOODOATH

We made a blood oath...

and yet the promise of it dissipated with the conversation I often expected.

 

As much as I’d love to over-describe, as some might expect me to, the weight of how I feel while concocting the narratives of Univerza, my writings mislead me.

 

I might say the campfire stories I told, which wrote themselves, are but a light in a pitch forest as I meander away ...

Read and leave comments (0)

🌷(1)

lovenaturepoetry communitypoetrycommunitywriteoutloudSpoken Word poetryfriendship opportunist genuinescience fictionfantasyhopeeternal

The Legend of the Gawanjee

In the ancients days,
of the 1980’s.

Stories flew
around the middle school.

About a beast in the woods,
called the Gawanjee.

It came from the Pit,
of an old coal mine.

It was part lizard-man,
and a part Bigfoot.

It slept in the warmth,
of an old gob pile.

And in the winter,
it could be seen frozen.

In the ice,
of the deep, dark lakes.

Kids would tell,
of being chas...

Read and leave comments (3)

🌷(6)

FantasyStoryFearMonsterKids

you know the bliss of evil

i've seen the smallest, tall creatures be eaten alive from the inside.

a quick glance to the left and under the bed will tell you all you need to know. 

the festering, rotten bed frame.

assembled by the very thing that chained me onto it for years.

but when i finally broke my own chords, vocal and the ones restraining,

another creature crawled from under the bed and took my place. 

...

Read and leave comments (0)

🌷(5)

poetrypoempoetprosestoryshort storyfictionfantasyteensadsad storybasedhorrorevilbliss

skinny dipping

skinny dipping

 

I saw the two of you at the spring

skinny dipping

 

splashing and having fun

 

were you on your lunch break

or did you call in sick?

 

if he ever swims away

you know that I am here

with goggles and snorkel tube

 

to show you things you have never seen before

 

Read and leave comments (2)

🌷(6)

jealousyfantasywishingswimming

GODDESS

You're a Goddess he said 

A sexual Goddess 

There's something about you that makes me obsess 

You own me he said 

In that way for sure 

The queen of my bed 

I can't take no more 

This power you hold and your sweet non intention 

Like a spell you control 

This whole new dimension 

Fantasy maybe

Closeness is tension 

Yes shy modest maybe 

Sex Goddess Lady 

H...

Read and leave comments (0)

🌷(3)

obsession?sexual goddessFantasygoddess

Metamorphous

You’re right

3 years ago, I viewed frogs as aliens

Now I wonder whether they’re angels

Months ago, I hated the sound of songbirds

Now I write their songs

I tweet along

Everything I did, I did do

It still was

Even if it no longer is

Whatever I am

I still am what I was

Even if I no longer am

You’re right

I was right and now I’m left

But the person I was hasn...

Read and leave comments (4)

🌷(7)

changeevolveadaptdifferenceafraidgrowsameanxietymatureoldlifequirkyrealrealismfantasyimagerymetaphorpersonalityfearcomfortworlduniverserandomsocialsocietypersonpeoplehumanmind

waiting for the first snowflakes

waiting for the first snowflakes

 

leaves

red, yellow, and orange

have long since gone

 

grass has turned brown

 

frost has covered the land

 

afternoon sun is low

in the southern sky

 

geese have flown

in the blue heavens

south for winter food

 

squirrels gathered

nuts and stored

them in their nest high in the trees

 

next-door nei...

Read and leave comments (0)

🌷(5)

fantasyfireplacesnowthoughts

Descent

roped together

on a cliff wall

keep going for there's doom should we stall

 

momentum counts

never look down

you look enchanting in your wedding gown

 

hope for no rain

dry grips better

black granite's awkward when its wetter

 

below is what

we left behind

up there who knows what we'll find?

 

the air is rare

birds swoop and cry

into ragged fea...

Read and leave comments (1)

🌷(2)

dreamingremorseclimbersfantasydeathflight

Respect Women, He Said

Respect Women, he said

I remember my skin was tight coming in from the low of a Maine night

When she

When she

When she

When she

Discovered my claims of

I could walk better, I ain’t in pain

But she knew something other than how my words were arranged

it were the muscles in and around my mouth, sculpting my face

Or it was the bags under my eyes

She related to when ...

Read and leave comments (0)

AbuseLoveDreamsLossDrugsAlcoholFamilyfantasyhopeeternal

Listening to Heart ❤ !!

Living a life of fantasy is such fun.

Once you give your life control to your heart,

you begin to enjoy its every part.

At times listening to heart gives memories,

and you can spend your life with its stories.

 

I lived my 10th grade in the fantasy world of reality

when I gave my life control to my feelings impatiently.

Something I'll never regret,

not even in the days o...

Read and leave comments (0)

🌷(1)

advaita singhballetfantasyfeelingslivingloveloverspoempoetpoetry

Every Part of You

I want every part of you on me

Catch my rhythm baby

Let me pound you to the beats of our hearts till our souls get lost

Lets find them in each others eyes

Give me something to play with somewhere to start

Tell me where you want me to finish

That climax we been chasing is within our reach

Why are you running from me entering your domain we have been here to many times

Maybe ...

Read and leave comments (0)

🌷(1)

anticipationfantasyracingsex

Filtered Memories

Back seat kisses, 

backyard volleyball,

barbecues, 

long walks in the woods, 

sunbathing on the beach, 

smiling, laughing,

talking for hours, 

holding hands, 

slow dancing to George Straight songs,

making love until dawn, 

falling asleep in each other’s arms...

Filtered memories, 

behind the sheer curtain of my mind,

or fantasies, 

found in a bottle

of ...

Read and leave comments (0)

🌷(6)

Fantasylifelovememoriesrelationships

NEW ALBUM: 'Crow Lore' by THE CROWS OF ALBION

I have been posting poems during lockdown based on the concept taken from a much earlier poem called 'Cycle Of The Scarecrow' a fantasy piece which tells the tale of a scarecrow who is brought back to life by a witch and walks the fields of Albion. It is a reflection on the changing seasons and of growing old - and the premise of 'what if I had my time again?
It was released today as a digital do...

Read and leave comments (1)

🌷(3)

crowlorefantasyfolkfolk lorehorrormusicnew albumreligionrock

Damnation Trail

Damnation Trail

 

Through forests dark and shadowed vale

He follows the damnation trail

Along the river’s twisted course

Through bracken thick and clutching gorse

The ancient path cut through the land

He walks with devil’s hand in hand

 

And where his steps flatten the crops

No more will grow the wheat and hops

For he has footsteps cast in death

He steals the fa...

Read and leave comments (1)

🌷(8)

CrowLorerebirthdamnationreaperdeathcursedgothichorrorfantasyfolklore

Corruption

Corruption

 

Here in the verdant meadows

All on a summer’s day

The dreaded army of the dark

Met with the noble fey

They fought until the long sundown

And the lost blood of the dead

Soaked into the sacred ground

And turned the roses red

 

When the fight was over

And the legion of the flies

Had swarmed across the corpses

Stealing hope from sightless eyes

...

Read and leave comments (2)

🌷(5)

CrowLorecorruptiontemptationtheftregretscarecrowmythfolkloregothichorrorfantasy

CrowLore

Crow Lore

 

We sit and watch the world go by

On fences long and oak trees high

The waxing moon the setting sun

We are the crows of Albion

 

We chronicle the human ways

Their restless nights and confused days

Mother, daughter, father, son

We are the crows of Albion

 

Our stories written down in books

Guarded well by crows and rooks

And no one knows what we ...

Read and leave comments (1)

🌷(3)

CrowLoremythfolktalecrowsstory tellinggothic horrorfantasy

Lazarus Curse

Lazarus Curse

 

I trudge across these ancient lands

Where crops are reared by human hands

And all I leave are footsteps deep

a crop the scythe will never reap

 

I see the changing seasons turn

The new shoots grow, bonfires burn

From the soil the world will grow

I track the sacred rivers flow

 

These things of beauty pass me by

I have no soul I cannot die

F...

Read and leave comments (2)

🌷(4)

zombieundeadfalse promisecrowlorefantasygothichorrorfolk tale

Boy and Kite

kite and boy

 

a paper kite

flutters in the wind

making wonderful sounds

back to the boy holding

the end of the string

 

kite dips and smiles

at boy and dances

little jigs as its string

is held taut

boy smiles back

 

a strong wind begins to blow

kite string breaks with a snap

startled boy looks up

and sees kite start to

fly in erratic patterns ...

Read and leave comments (0)

🌷(1)

fantasykitesemotionshopefulescape

Alternate Universe

In another life 

you are mine and I am yours

all is as it should be,

I'm enthralled with you

and you with me.

 

Just as I am now 

only having eyes for you,

you knowing me

even more than you already do

but without all the boundaries

and our courtship being taboo.

 

I surrender completely,

you let me in,

joy and possibilities

abounding,

no prior kno...

Read and leave comments (3)

🌷(3)

admirationfantasyHopeful

The Mandrake Curse

The Mandrake Curse

 

I spied the purple mandrake flowers

Sitting in their nest of green

And foolishly looked to rip them

From the earth they serenely sat upon

And everywhere a shriek echoed

Across the woods and leafy vales

and to my weary eyes I saw

The bulbous body resurrected

 

A face demonic in its glare

For being torn from fitful slumber

Wizened arms of k...

Read and leave comments (0)

🌷(1)

napowrimo2020day 11mandrakemythpoisonflowerfantasyhorror

Muses, Sins & Soul Ties

Is it a sin for your muse

to inspire mine,

provide momentary escapes

from loneliness, pain,

the daily grind,

give words to fantasies

of the mind,

connect soul ties.

It’s hard to believe

a God of love

would consider musing 

a crime. 

If it is, that’s not a religion

to which I subscribe. 

 

https://youtu.be/tjdGgcFf-T8

Read and leave comments (10)

🌷(6)

faithFantasygodlovelustMuserelationshipsreligionsinsoulmatesspirituality

Only In Dreams

How wide is the ocean, how far away are the stars

Is there really life up there on Mars ?

heaven they say is above us and hell below

Many question but answers are few you know 

Nothing is for certain except I know I love you

in my dreams your my lover with out you I'm blue

Its Valentine's Day made for lovers who care

Yet  we only meet in dreams your always there

We make lov...

Read and leave comments (0)

DreamloverFantasy

If Poems Were Paintings (A Scabrous Fantasy, Written After Watching J. Koons at Work On BBC4)

This poem was painstakingly transcribed by 23 unpaid

interns labouring under my cool, indifferent 'tutelage'

(and who, after each day's work is finished, in bars and cafés

across the city will pretend to their friends how valued

they're made to feel as students and protegés of mine.)

                                                                                                   E...

Read and leave comments (1)

🌷(2)

artfantasywriting

Fantasy

Tangled and bruised by the brutal truths.. 
Hiding in the warmly lit alleys of hope
Escape, seems a blissful route..
Comfort of illusions help to live and cope.. 

Reality strikes with consistently lethal blows.. 
Shattered, fractured, stifled moments.. 
Often leaving heart and soul somewhat hollow..
Mind awakens to unreal incitements.. 

Storm of the night left the branches barren.. 
L...

Read and leave comments (0)

fantasyhopeeternal

That Yellow Attire

Quiet she was from the bottom of her heart,

I never knew what she hid inside…

I made a fool of self on my part,

Just being a manager and may be a guide,

She was the girl who I took a girl always…

Not knowing there was a woman in her.

All the years I knew her she had her own ways,

And on her own benchmarks she did deliver….

I dared not to touch upon her ever nor even ask,

...

Read and leave comments (0)

🌷(1)

BeautyromanceFantasy

Becoming

If you become 
what you think about 
most of the time... 

I am becoming 
poetry, a lyrical 
fantasy floating 
in rhyme. 

I am becoming 
love and light,

Doing my best
to do what's right.

I am becoming 
forgiveness 
and peace. 

Healing souls
like Wayne 
and Louise.  

I am becoming
who God intended
me to be.

Leaving a loving
legacy. 

I am becoming 
free.

###

...

Read and leave comments (2)

🌷(8)

lovelightlegacyhealingsoulsdestinypoetryfantasyrhymeGodfaithforgivenesspeacefreedomWayne DyerLouise Hay

Fantasy Prone Personality.

This bed it is a bridge
Of what is real and fantasy
I despise reality 
I'd rather keep dreaming
Where I am free
To be alive
Where I will thrive 
And my heart can be
Free from knives 
I will not cry 
I can not feel 
I stay in bed to escape what is real

Read and leave comments (0)

🌷(3)

Fantasypronepersonalitydisorderdepression

Aquatic Stardust - a freewrite

Aquarian Aquarius,
everyone be hearing us.
What an exciting life you lead,
cosmic superhuman centipede.
I’m Centric G pause for the D:
ejaculating antiquating - even thoughts dilapidated.
You should go through twice
extinguish anguish from your life
cosmic zombie souls are sliced.
Universal detoxification 
electrocuting nation-notions
rubbing Atlas, struggled rolling
infinitesimal scro...

Read and leave comments (0)

poetryrapcomedysemanticssemantic fieldssilly semanticsfreewritefreestyleloveuniversegalaxiesearthwaterlifefantasysci-fidoggosdogsmemessilliness

The Beast Beneath The Beck

The Beast Beneath The Beck

 

The beck at Westgate End is full of weeds,

its water is a muddy shade of brown,

confused ducks die within anaemic weeds

as sunken shopping trolleys pull them down.

Sometimes you hear a cold slithering splash,

as though some ancient creature has slid in

to feast upon the centuries of trash.

Who knows what evils are contained within?

 

It...

Read and leave comments (5)

🌷(2)

fantasyShakespearean Sonetwakefield beckwstgate

every word

“ …. every word is like an unnecessary stain on silence and nothingness” (Beckett)

 

every word

Be born, live, cry, die; always cry.

Why cry?

 

Why not?

 

I am not on Earth

to fail to exist,

or any other madman's fantasy.

 

Sammy found something

worthwhile:

he found

- Nothing.

 

Eat, move, create, decay;

earthen in earth

for the Archaeologis...

Read and leave comments (0)

cryEarthfantasyNothingearthengnomic

I had that dream again...

I had that dream again...

You and me dancing on some random beach.

 I felt your hands on my thighs,

moving me gently with your warm eyes.

You were looking at me like if it was the first time, 

the first time of holding me with your warm hands. 

I remember it clearly now.

My head was resting on your chest,

I know you were smelling my hair and

playing with it just like y...

Read and leave comments (0)

🌷(2)

couplesdreamsemotionsfantasyfeelingslovenewpoetpoetryrelationshipsromanticsadwonderswriter

Blame the trees...

Love brightens even more with the trees

My inner thoughts of you are translucent on my body

Every second with you feels like infinity 

Infinite beauty 

Infinite scares that you leave 

Anything is possible with you

When I get lost 

Your there to show me the way 

I hope this explains how much I love you

Sometimes your love puts me in a trance

Words are difficult 

Bod...

Read and leave comments (1)

loveBeautyfantasymindbody soul

BRAM STOKER'S GHOST

Bram Stoker's ghost is queueing

at the turnstile of the National Trust.

He's hoping for a viewing

of the abbey ruins at Whitby

the church and the plunging steps

where Lucy Westenra descended

entranced, danced to Dracula's tune

 

"Was Dracula real" he asks himself

as he looks far out to sea,

"or another facet, a commercial asset

of tragic history."

Read and leave comments (2)

🌷(1)

Fantasy

THE WAY IT'S GONNA BE

When i'm done with being young

i'm gonna be the next king.

That's the way it's gonna be

are you with me?

I'll be famous obviously

and appreciate society and everything.

 

I wouldn't let the country down to be honest,

or let people rub me up the wrong way,

i'd make sure my family

would have somewhere to stay.

 

All my mates would be doing well

'cause they nev...

Read and leave comments (0)

🌷(1)

Fantasy

Baffled

I don't know what to say other than ......

I wish 
I could hold you tight
And that you'd hold me 
In a cocoon of togetherness, spun of the strongest thread
Only to break as beauty forces itself out into the world
It's metamorphosis delicate, fragile
Exquisite in its simplicity 

I wish 
I could kiss you .......

(C) Pixievic

 

https://soundcloud.com/vicki-ayers/baffled-written-...

Read and leave comments (1)

🌷(4)

loveFantasy

Tumbleweed

Tumbleweed

 

In a town called Tumbleweed

sound is deadened

so that every conversation

crawls like a gentle breeze

through cotton wool.

 

Beggars are kings,

politicians pariahs,

policemen thieves,

priests parasites.

Suzie is a victim.

 

The streets of Tumbleweed

host sinners, saints and surrogates

sneering into bibles

left to them

by agnostic pa...

Read and leave comments (2)

🌷(1)

apocalypsefantasygothichorrorurban decayvampiremetaphor

Riversong

like
a trickle 
from mountain rain 
it starts ......

my
Desire

a quiver of droplets
converging together
coursing through my body 
consuming my thoughts
babbling down my contours
into my valleys
soaking my senses 
with lust
growing in need
shuddering across rocks
rapidly gaining in momentum
uncontrolled
in a frenzy of whitewater 
finally 
reaching the drop
tantalising 
at ...

Read and leave comments (7)

🌷(1)

Orgasmdesirelustfantasy

Answer to a Prayer

I was kind of hoping,
That you would come along,
Like the answer to a prayer,
And the music to a song.

Like the kind of thing that happens,
At a special place and time,
That will change our lives forever,
Like a fantasy of mine.

The fantasy was there before,
I ever knew your name,
And now that I have found you,
We will never be the same.

So, pardon, if I look at you,
Forgive me ...

Read and leave comments (3)

alongalwaysmusicsonganswerspecialplacetimebeforefantasyForgivefoundhopingIprayermeneverpardonstandingstarechangeforeveryou

The Ghost That Flitters

The ghost that flitters through your sleepless night

may be fully alive in another’s  daytime sight,

for the dimensions where they appear as a wisp

may not be the same as that where they’re kissed…

 

Imagine if your mind is ready for this notion just yet

that the ghosts which you see are not dead for I bet,

what you see is merely a slim projection coming from

another di...

Read and leave comments (0)

fantasyfearghosts

IN THE TOWER

In the fustian gloom of the tower

something moves to give room to spiders.

the lips of hell part with a smile

pleased with its progeny and its guile

          and the sun slinks away

          from its slit in the wall

          where archers of old

          felled the pressing horde.

Nothing has ever left these chambers

and fear congeals with rotting straw

strewn ac...

Read and leave comments (2)

Fantasy

Hunt of the Men to rule cycle

Into the vortex of timeless end
Where no other creature has yet begun
Turning from a rhythmic flute
The rabbit jumps into chutes
Darkness appears from the back of earth
No light shines longer yonder the pearl
Smoke derives from umbilical butterfly
Trapped beneath the Cheshire cat sign
Gulping milk to fasten bloom
Cookie crumbs, sugar rush delusion
To enter, only inception of living
Soul...

Read and leave comments (0)

Fantasyfantasy realmsAlice In Wonderlandmenstrul cyclelife and naturecycle of lifepath of lifehuman journey

Blue Flare

~~Orphan phantom all alone
Within reach from dusk till dawn
Scuttling limbs of Arthropods
Play the harmonious earthly cords
Bitter velvet in water’s core
Chanting monks, four by four
Angelic screams jogs the storm
As hounding harps rabbits their form
Burning icebergs cremating ghoul
Ecstatic mermaids make love to fools
Travellers boat, companion Charon
Spring has lost to Persophone
Ele...

Read and leave comments (0)

Greek MythMythologyunderworldgoddessghoulsfantasy realmsFantasyfantasy planetfiction

Dumping a fantasy

How do you dump one who's never been yours,

who barely cares you exist,

someone whose body you never have held,

whose mouth you never have kissed?

Though there's nothing to dump, dump you I must,

Dump you right out of my head

where images of you haunt and tease,

caused (to be fair!) by nothing you've done or said.

Tomorrow I get my life back I hope

after a fantasy-nightm...

Read and leave comments (2)

dumpinglossfantasy

Beauty Unseen

Frozen sighs shadow thick,

Fire heaving through the giants teeth,

Her silk dress gliding gently, serene,

Eyes beating like drums on Winter Eve.

He quells her silent tears,

Caressing her sea of particles,

Eliminating the smudges wept across her jaw,

For her eyes spilled a thousand written articles.

"Beauty, beauty is within and without,"

He articulates, palm leveling her ...

Read and leave comments (0)

Celticfantasylovehopebeautynaturefriendship

Show more entries …

This site uses only functional cookies that are essential to the operation of the site. We do not use cookies related to advertising or tracking. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message