Rock (Remove filter)

Recent Comments

julie callaghan on Dalyan
2 hours ago

jennifer Malden on The Stalker
3 hours ago

jennifer Malden on Siblings
3 hours ago

jennifer Malden on Sweet Dreams
3 hours ago

jennifer Malden on Halloween
3 hours ago

Saul Bennett on Not Everybody Likes Poetry
3 hours ago

M.C. Newberry on GONE
5 hours ago

julie callaghan on An Eerie Scene
6 hours ago

Adam Whitworth on Shopping Cart
6 hours ago

Greg Freeman on Siblings
11 hours ago

Prisoner

Prisoner

Don’t feel like I belong here

Feel like I gotta go

No need to question

I think that you should know

Tired of gazing at shoes

Tired of singing the blues

I feel like a prisoner

 

They’re all telling strangers our life story

They all find their comfort from their superiors

Tired of gazing at shoes

Tired of singing the blues

I feel like a prisoner

...

Read and leave comments (0)

lyricspunk poetryrocksong

Sleep Over

Sleep Over

The phone rings it’s for me

What you gonna say

You have a sleep over

The phone rings it’s for me

What you gonna say

You have a sleep over

Sleep over

Sleep over

 

All night all night all night all

Gonna have ourselves a sleep over

All night all night all night yeah

 

You bring a friend and I’ll bring mine

Gonna have ourselves a real good time

...

Read and leave comments (0)

lyricspunk poetryrocksong

Hallucination

Hallucination

 

Don’t worry now it won’t take too long

I feel the effect coming on

Sullen figure overhead

Points out what is good and what is bad

 

Hallucination Hallucination

Come again and end my frustration

 

Tongue tied with Northern Lights all night long

Tried to smoke a cigarette but it’s too strong

Voices in my ear tell me it’s alright

The impossible...

Read and leave comments (0)

lyricspunk poetryrocksong

Lori Looker

She greets you with a smiling face

A pretty girl with womanly grace

She couldn’t stand to touch anyone

The coldness felt made her come undone

 

I said Hey what have you done

I said hey yeah hey what have you done

 

Husband noticed some strange behavior

Rancid meat in the refrigerator

Psychosis calls to everyone

Writing sevens on the wall

 

Lori Looker

 

...

Read and leave comments (0)

lyricspunk poetryrocksong

Curiosity

Looking out from the inside

I find where to begin

Keep up on the outside

And letting them sneak on in

 

You’ve got your business

You’ve got your pride

But it ain’t gonna help you

With what you feel inside

 

Curiosity makes the best go down

Curiosity is going on in the town

 

People tell me they walk on by

Some give me a passing glance

Some stop and loo...

Read and leave comments (0)

lyricspunk poetryrocksong

NEW ALBUM: 'Crow Lore' by THE CROWS OF ALBION

I have been posting poems during lockdown based on the concept taken from a much earlier poem called 'Cycle Of The Scarecrow' a fantasy piece which tells the tale of a scarecrow who is brought back to life by a witch and walks the fields of Albion. It is a reflection on the changing seasons and of growing old - and the premise of 'what if I had my time again?
It was released today as a digital do...

Read and leave comments (1)

crowlorefantasyfolkfolk lorehorrormusicnew albumreligionrock

Trapped In Amber

tree resin could not compare,

so soft and adhesive as glue,

drawn in like a starving fly, I

gorged on the love she grew

 

she's gone now, felled by time,

ironic mere insects survive her,

yet we are safe as any house,

secure but trapped in Amber

 

I'm stuck and its getting harder

I watch myself get fossilized,

years go by and I turn to rock,

humble yet curious...

Read and leave comments (1)

amberflyfossilizedhoneypotnectarrocktrappedtree resin

Heartfall

hanging there its waiting

each and every little part

dangling just on the edge

the avalanche in my heart

 

snow melted has frozen,

stones skitter on a rink,

quick to rip and tumble

before I can even think

 

waiting at a precipice

crawling ever nearer

my fate in your hands

kismet never clearer

 

further descent of snow

dead weight on icy rock

I can...

Read and leave comments (0)

avalancheinfidelityprecipicerinkrockshocksnow

Hinterland

You loved peering at gravestones

I'd popped out of church for a smoke

In a tempest of wind and rain

We managed to enjoy a quick joke

 

After we met in a graveyard

That hinterland of heaven and hell

You became my rock of ages

My very own graveyard belle

 

You spoke of granite and marble

Sandstone's tendency to crumble

How weathered stones, though mossy

Made yo...

Read and leave comments (0)

basaltbellegraveyardheadstonehinterlandhumblerock

SCREAMING BLUE MURDER - NEW ALBUM

I have released a new poetry/music album titled 'Screaming Blue Murder' under my recording project THE CROWS OF ALBION. The title track is provided above.

There are 16 tracks (1 cover) all of which were originally posted as poems on Write Out Loud.

Over the past 5 months I've been working them into 'songs' with a great producer - John Kettle from Merry Hell at Music Projects in Wigan.

The...

Read and leave comments (7)

crows of albionfolknew albumpoetrypunkrockscreaming blue murder

The Long Player

Here is old poem idea I've had for ages about favourite album titles and the feelings that the music of each inspired in me at the time.  My old vinyl records - nostalgia.  You've got to guess the artists.  It's not laid out in a poem style fro a reason, and that's becasue a design friend of mine some years ago formatted (God knows how) into a circular text shaped as an LP.  It just needed a lable...

Read and leave comments (0)

bluesBritpopindiemusicpoppsychedeliarock

The Launch

Found the chords, the riffs are born,
got a front, an axe, a bass, some beats.
The song is written, the group is formed,
what name should the vessel take to the streets?

A mother?  A lover? Seek out a legend?
Symbolic?  Insane? Cast off the vote.
No taking the sis!  Impress my girl-friend
anchor success with a name like a boat.

Think of book; of a pub, of a film script;
see the soft s...

Read and leave comments (0)

bandsboatlaunchnamingrock

Roadie

Roadie.

When heavy metal bands reform
it’s nothing like it was in the day,
when daily excess was the norm
and we needed drugs to help us play.
From riding into the teeth of the storm
we had to curtail our wicked ways.

The Roadies still get us up to speed,
tune guitars - get everything we need.
They’re an invaluable, yet dying breed -
Roadies still get us up to speed.

Even though w...

Read and leave comments (1)

anti-drugsdrug referencesdrugsreformed bandsroadierock

GLAM!!!!!!!!

GLAM!!!!!

 

a bald old man

in glitter suits

gets vertigo

on platform boots

his cigar smoke

hangs in the air

whilst outraged fathers

simply stare

and comment on

the raging poof

who hangs precariously

from the roof

or unnoticed

passes by

in the background

on the sly

his black mascara

and red nails

his pouting preening

never fails

to s...

Read and leave comments (4)

childhoodglamglam rockglitterrocksavillescandalseventiestainted

Team GUM at Riff Awards/Riff News

Team GUM are taking on the Riff Awards.

Step 1.

Like the Riff page here: https://www.facebook.com/RiffMediaUK

Step 2.

Send an email to: adam-ruane@hotmail.co.uk

Put forward Kris Fogg for BEST NEWCOMER.

Put forward Ushiku Crisafulli for BEST NON MUSICAL ENTERTAINER.

You'll see us both repping Riff at RIFF SURVIVAL SUNDAY - MARCH 31st

Cheers,
Ushiku.

Read and leave comments (0)

ArtistsAwardsComedyCountryFoggHip HopIndependentIndependent MusicKrisKris FoggLocalLocal ArtistsMusicMusiciansRiffRiff AwardsRiff Survival SundayRockSpoken WordSundaySurvivalThe Five Faces of FulliUshikuUshiku CrisafulliVariety

Mendres Monologue

I'm playing Mendres, the identity of the devil and lead antagonist in an upcoming British film called Dark Domain.

I wrote this piece as a spoken word/metal fusion piece for the project.

_____________
 

Some say the pen is mightier than the sword,

But they all fear the might of my demonic horde.

I'm Mendres, I'm the devil incarnate,

I use the Dark Domain and I seal your fa...

Read and leave comments (0)

dark domaindeathdevilevil.MendresmetalpoetryrockSatansci-fi

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message