Echoes: ‘a glorious anthology… bursting with delightful poems’ Buy now. Limited stocks.

Popular last 30 days

War love poetry Iran poem God Starmer fascism life healing

Popular last 12 months

love poetry nature life poem War Trump hope god Gaza

rock (Remove filter)

Roots

Life is solid, made of earth and stone,
of roots that sink deep into the silence of the soil.
Each step, an echo in the field of time,
each breath, a reminder that we are (in)finite.
There is strength in the winds we cannot see
and in the falling leaves that fear not the winter.
Love is not fleeting, but like the rock,
firm, built in the fissures of being.
And when the sky closes,
when th...

Read and leave comments (2)

🌷(6)

breathdayearthechomemoryrockrootsskystone

NEW ALBUM: 'Crow Lore' by THE CROWS OF ALBION

I have been posting poems during lockdown based on the concept taken from a much earlier poem called 'Cycle Of The Scarecrow' a fantasy piece which tells the tale of a scarecrow who is brought back to life by a witch and walks the fields of Albion. It is a reflection on the changing seasons and of growing old - and the premise of 'what if I had my time again?
It was released today as a digital do...

Read and leave comments (1)

🌷(3)

crowlorefantasyfolkfolk lorehorrormusicnew albumreligionrock

Trapped In Amber

tree resin could not compare,

so soft and adhesive as glue,

drawn in like a starving fly, I

gorged on the love she grew

 

she's gone now, felled by time,

ironic mere insects survive her,

yet we are safe as any house,

secure but trapped in Amber

 

I'm stuck and its getting harder

I watch myself get fossilized,

years go by and I turn to rock,

humble yet curious...

Read and leave comments (1)

🌷(4)

amberflyfossilizedhoneypotnectarrocktrappedtree resin

Heartfall

hanging there its waiting

each and every little part

dangling just on the edge

the avalanche in my heart

 

snow melted has frozen,

stones skitter on a rink,

quick to rip and tumble

before I can even think

 

waiting at a precipice

crawling ever nearer

my fate in your hands

kismet never clearer

 

further descent of snow

dead weight on icy rock

I can...

Read and leave comments (0)

🌷(2)

avalancheinfidelityprecipicerinkrockshocksnow

Hinterland

You loved peering at gravestones

I'd popped out of church for a smoke

In a tempest of wind and rain

We managed to enjoy a quick joke

 

After we met in a graveyard

That hinterland of heaven and hell

You became my rock of ages

My very own graveyard belle

 

You spoke of granite and marble

Sandstone's tendency to crumble

How weathered stones, though mossy

Made yo...

Read and leave comments (0)

🌷(2)

basaltbellegraveyardheadstonehinterlandhumblerock

SCREAMING BLUE MURDER - NEW ALBUM

I have released a new poetry/music album titled 'Screaming Blue Murder' under my recording project THE CROWS OF ALBION. The title track is provided above.

There are 16 tracks (1 cover) all of which were originally posted as poems on Write Out Loud.

Over the past 5 months I've been working them into 'songs' with a great producer - John Kettle from Merry Hell at Music Projects in Wigan.

The...

Read and leave comments (7)

🌷(8)

crows of albionfolknew albumpoetrypunkrockscreaming blue murder

I found a rock in my shoe by Belade

I found a rock in my shoe by Belade Kodasso

I found a rock in my shoe

I found a rock on a shrew

I found a rock in my bed

I found a rock on my head

I found a rock with my tutor

I found a rock next to a sharpshooter

I found a rock close to my teacher

I found a rock for the grim reaper

I found a rock in my hair

Try find one if you dare

Read and leave comments (0)

funkidspoetryrockshoe

The Long Player

Here is old poem idea I've had for ages about favourite album titles and the feelings that the music of each inspired in me at the time.  My old vinyl records - nostalgia.  You've got to guess the artists.  It's not laid out in a poem style fro a reason, and that's becasue a design friend of mine some years ago formatted (God knows how) into a circular text shaped as an LP.  It just needed a lable...

Read and leave comments (0)

bluesBritpopindiemusicpoppsychedeliarock

The Launch

Found the chords, the riffs are born,
got a front, an axe, a bass, some beats.
The song is written, the group is formed,
what name should the vessel take to the streets?

A mother?  A lover? Seek out a legend?
Symbolic?  Insane? Cast off the vote.
No taking the sis!  Impress my girl-friend
anchor success with a name like a boat.

Think of book; of a pub, of a film script;
see the soft s...

Read and leave comments (0)

bandsboatlaunchnamingrock

Roadie

Roadie.

When heavy metal bands reform
it’s nothing like it was in the day,
when daily excess was the norm
and we needed drugs to help us play.
From riding into the teeth of the storm
we had to curtail our wicked ways.

The Roadies still get us up to speed,
tune guitars - get everything we need.
They’re an invaluable, yet dying breed -
Roadies still get us up to speed.

Even though w...

Read and leave comments (1)

anti-drugsdrug referencesdrugsreformed bandsroadierock

GLAM!!!!!!!!

GLAM!!!!!

 

a bald old man

in glitter suits

gets vertigo

on platform boots

his cigar smoke

hangs in the air

whilst outraged fathers

simply stare

and comment on

the raging poof

who hangs precariously

from the roof

or unnoticed

passes by

in the background

on the sly

his black mascara

and red nails

his pouting preening

never fails

to s...

Read and leave comments (4)

childhoodglamglam rockglitterrocksavillescandalseventiestainted

Team GUM at Riff Awards/Riff News

Team GUM are taking on the Riff Awards.

Step 1.

Like the Riff page here: https://www.facebook.com/RiffMediaUK

Step 2.

Send an email to: adam-ruane@hotmail.co.uk

Put forward Kris Fogg for BEST NEWCOMER.

Put forward Ushiku Crisafulli for BEST NON MUSICAL ENTERTAINER.

You'll see us both repping Riff at RIFF SURVIVAL SUNDAY - MARCH 31st

Cheers,
Ushiku.

Read and leave comments (0)

ArtistsAwardsComedyCountryFoggHip HopIndependentIndependent MusicKrisKris FoggLocalLocal ArtistsMusicMusiciansRiffRiff AwardsRiff Survival SundayRockSpoken WordSundaySurvivalThe Five Faces of FulliUshikuUshiku CrisafulliVariety

Mendres Monologue

I'm playing Mendres, the identity of the devil and lead antagonist in an upcoming British film called Dark Domain.

I wrote this piece as a spoken word/metal fusion piece for the project.

_____________
 

Some say the pen is mightier than the sword,

But they all fear the might of my demonic horde.

I'm Mendres, I'm the devil incarnate,

I use the Dark Domain and I seal y...

Read and leave comments (0)

dark domaindeathdevilevil.MendresmetalpoetryrockSatansci-fi

This site uses only functional cookies that are essential to the operation of the site. We do not use cookies related to advertising or tracking. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message