Poetry Blogs (colours)

colours (Remove filter)

Popular last 30 days


on the roof hawk chicks

secure at


floors high

nestle their mother

under bright sun


the male soar

free to hunt,

enquiring amber eyes seeing

colours we can't



disturb the

eyrie no

screams ascend or

smoke black as

seventy-one funerals

Read and leave comments (1)

colourseyrieflameshawksafescreamssmoketwenty three floors

What Lies Above And Below Us

entry picture

Far above us

The sky bursts into colours-

Blue, purple, grey, orange,

With red and all the hues in its range.


Miles beneath our feet

Are secrets buried,

Arcane and deep.

Their ampoules once known to everybody.


What goes overhead

Suffuses stars and their milky shells.

The departure from earth melancholic but serene,

Leaves behind shimmering trails that spe...

Read and leave comments (12)



How they have fallen,
Laying thick,
Pressing the jostling grass
Under them.
Obliterating it from sight.
Their browns and yellows brighter
Than the grey above.
Achieving a moment of glory,
In death a dominance.
Looking up to freed branches
Framing veiled light,
Had they thought to fly,
Letting go their source of life?
How they have fallen!


Read and leave comments (2)



Waking to see autumn's lustre

lit on my beech


rust leaves gilt glowing

red gold bathed by


a rising sun's first grasp

of day.


Turning to see gold amber cirrus

low light the east -


beneath a darker grey purple

cloud bruise


that golden gleam of

dawning dawn.


So my sad grey purple dreams

dawn dim


their dark ghosts disconnect ...

Read and leave comments (0)



It was black and white

for a while


Until the first line

was drawn


Then the pale grey people

the people who could only draw

a black cross

in a white box

began to sense

other possibilities

shading the palette


The colours of debate

splashed clumsily

over everything:

the harsh red of anger

the yellow of injustice

screaming crimson

a har...

Read and leave comments (0)


An Autumn Song for the Traveller

Before I go

Let me drink this rich wine

Let me sing my delight


This gold red dawn has promise:

vibrant with the cold sun

vanishing valley mists

leave damp spider web to shimmer

mistdrops on the long reeds

and ungathered lawn leaves

damply shining

against the muted green of wet grass.

This amber morning has perfection:

wonderfully wooded leaf tints


Read and leave comments (1)


Colour 309 U

As we sat

over coffee

she said

                she liked

                the blue

                of the wall


I could see a shade of green

                in the blue


The next table

                agreed blue






We called it

Mermaid Blue


I wondered if that lady

                at the next ta...

Read and leave comments (6)


A two week old cup of homemade lemonade right before I brush my teeth with vinegar

Losing all my trust,
yet I still believe you,
admitting my defeat.

You have lied,
many times before,
and you still told me things,
no body knows.

Showed your true colours,
but never showed your face.
Flirt with the thought of death,
somehow you were stopped,
but this time,
nothing stands in the way,
except for a bottle of rum,
a golden pen and a writing you'll never understand.

Read and leave comments (0)



A thought awakes me,

and I cling on to the memory of a loved one.

Bird song, faint but swelling,

catches at my heart,

as I pull up the blind revealing the world below.

Light beckons me,

and I press my face against the pane.

I gaze, long and hard as if searching for someone.

My breath mists the glass, and I wave it away,

"Here I am".

Without a sound spoken I have woken...

Read and leave comments (4)



I can taste the colours of your kiss
Fiery crimsons bursting through 
Mellow yellows
Exploding into sweet tangelo
Cool blues
Turning violet
As my senses play this quiet duet

I hear music when you touch me
Bass lines throbbing alongside
Exotic rhythms
Tumbling into trembling strings
Soaring voices
Dulcet tones
Within your music my body groans

I can smell flowers in your words

Read and leave comments (5)


funeral days

entry picture

funeral days

funeral days
should always be like this

early mourning dew
in the eyes of those gathered
under a slate grey sky
(not blasphemous blue)
whose heavy tears
will splash
the golden Judas kiss
of leaves crackling
beneath disrobed trees
betraying the sadness
with their joyful colour

the heavy damp sods of earth
clinging close to the coffin
like the grief
that surrounds...

Read and leave comments (1)






Some of the weirdest shapes I’ve seen are hanging in the sky, a portent of things to come or so say the dark masters.

Are they here to protect us or to destroy us, to fill our lives with evil?

Iridescent colours cast their hue making shadows dance across the land.

In all the towns and cities the culturists plan their revenge to rid their domain of the dark m...

Read and leave comments (0)


This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message