SOUL (Remove filter)

Drifting

Until sweet sleep washes over you

And you allow it to carry you away

Peacefully surrendering to the tide

Abandoning your body...

You drift from the bay

Falling under the lapping waves

Deeper and deeper into calming darkness

Letting go and forgetting

At the very same time

Until eyes open like the shore

Crashing onto the rocks

And sun expands across you

Placing yo...

Read and leave comments (1)

🌷(2)

every dayexpectimpatientawaitsleepsurrenderseducerelaxpeacepeacefulforgetabandonbeachwavesseaoceanmetaphorfeelingmindbodyspiritsoulwashnapbrainlet goletting goforgettingawakerealitydriftrunescapereturn

The Beauty in Despair and Illusion

It is here that lies your beauty
do not testify to me anymore
of dandelions and daffodils
of butterflies and bees
do not sing like crows
beyond the dispersion of sight
then gather
in cold bare trees
sick with
discord
dislike
misfeasance.
The reward for
transgressions
destroys the cache
of elegance
of magnificence
of splendor
do not pour out sadness
breathless
from your panting ...

Read and leave comments (2)

🌷(5)

sightbeescrowscoldsickbeyondbeautydiscorddislikesplendorabysshopesadmirationsoulcolorsconclave

Light/Shadow

The light fades slowly on the horizon
like a farewell, hesitant and forlorn
and the night is born with no hurry to be night
lost in the shadows of what’s yet to be drawn

There’s something in the air, a gentle sigh
an unseen movement drifting through the trees
a secret vanishing with the breeze
perhaps a memory that never learned to fly

Words may fade
but silences still hold their weig...

Read and leave comments (2)

🌷(8)

lightshadowbreezeneverflydrawnsoulstatefadequietalonename

Vagabond

I know I'm not a hobo... on a train

But I feel like a vagabond... just the same.

My soul is like a wayfaring stranger,

Unable to settle down

Who's always just passing through

Going from town to town.

If I could just plant myself...

By a stream and let my roots grow...

I'd raise my branches toward the sun,

And bend when the wind does blow.

 

 

2009

Read and leave comments (0)

🌷(8)

SoulSoul SearchingRootsGod

Take Care Of Your Soul

 

It is cold for my soul,

Wrap it carefully,

Without any hole.

It feels so lonely.

 

 

Drafts can blow everywhere,

It's so easy to catch a cold.

Then you quietly declare

That it was a mental cold.

 

 

Wrap your thoughts in a warm scarf.

Don't keep your feelings in the cold!

Your soul shouldn't be ever tough,

"The soul is like a flower"- it was told.

...

Read and leave comments (0)

🌷(8)

soul

Possibilities

In the vast plains of time, where the wind is lost
Man, with curious eyes, gazes at the horizon
And in the infinity of the sky, which stretches beyond being
Possibilities blossom, like stars in a distant night

What will become of me, in the paths of chance?
Which road, by the moonlight, will stretch before my step?
I feel in my chest the pulsing desire of a vast dream
But doubt, like fog,...

Read and leave comments (0)

🌷(5)

Possibilitiestimestarsstepsilencewindriverlifewingsdayjourneysoul

a wise crank is a wise crack

spirits are a wise crank
spirits are a wise crack of a crank
a wise crack is a wise crank
a wise crack is a wise soul
a crack soul,a crack spirit,a wise crack
a crack spirit is a crack soul
a spirit is a spirit of a crack soul

a shadow is a shadow of a shadowy
a shadow is a shadowy of a wise crack
a shadowy is a shadowy of science
a shadow science is a shadowy of a shadowy
science is ...

Read and leave comments (0)

sciencewisesoul

Beauty

Your beauty makes YOU invisible

Do people see the real you or just your beauty? 

Beauty is a barrier 

I broke the barrier 

Read and leave comments (1)

🌷(4)

Beautysoulrealyou

Let the wolves run

Let the wolves run

I run faster

Let the wolves run 

I am stronger

Sure of myself 

I flex the muscles of my mind

No need to hide

I expel hexes in one breath,

You may not enter

Nor commit the theft 

Of my soul

You are uninvited 

Release the hatred from your heart

Vengeance is a waste of energy

To be enlightened is to be smart 

And rise above, rise!

I a...

Read and leave comments (2)

🌷(5)

Vengeancehateenergycleansepurifyspiritualexpelhexfreespiritsoulmindbodyfreedommeditationgrowdevelopstrengthbelieffaithself beliefsense of selfprotectioncursefightdefeatblack magicpredatorwolves

body,mercy,soul

the body of the soul is,
the mercy of the soul
a body is a mercy of a body
a soul is a mercy of a soul
the mind,body,and soul is the mercy,
of the mind,body,and soul
the mercy is the soul,the mercy is the body,the mercy is the mind

light is a barrier of light
light is a barrier of the mind,body,and soul
light is a mercy of light
light is a mercy of the body
light is a mercy of the sou...

Read and leave comments (1)

lightbodysoul

Trust...

They reach me,

And,

I give them my all,

Yet after that,

They leave me Alone.

They will come back,

Once again, for sure,

With a different face,

A different name,

A new personality,

All along,

And once again,

I will give them my all,

Will they, this time

Stay by my side?

I don't know,

But that's how Trust works,

That's how Life works.

 

Read and leave comments (0)

🌷(2)

optimismdistancemileslovetrustinfeelinglossdedicationtemptation2017poempoetryemotionsdeepdarksoulfoodsoulmindfulpositive

Be Who You Are!!!

Don't let them Judge You,

Don't let them Teach You,

Just be Who You Are!!!

Because,

You are Amazing,

Just the Way You Are...

Read and leave comments (0)

🌷(2)

self lovefire flesh love passion obsessionoptimisticoptimistLove yourselfsoulfoodsoulmindfulpositive

I: skeleton

Face like stone

Hard to read

I find myself taking pride

In my totem pole

Of expressions, I can hide

Masterfully deceptive

Every bit secretive

All heart without sleeves

Makes it easier to breathe

But being naked

Really stripping off

And just letting everyone watch

That is true strength

True power

Is knocking down this tower

Being bare

Just a sk...

Read and leave comments (0)

🌷(4)

skeletonvulnerableemotionconnectbravecourageoustruerealrawpassionsensationbeingaliveconnectedspiritsoulpowerdeceptivehideprotectdefencestonepoker facestillexpressarticulateunfilteredbold

Raw eggs

I tried beautiful,

I tried pristine,

I was no good at it

I’m not neat within

I’m not “clean”

Even externally, I cannot master

Clearing every bit of clutter

I’m raw, like an egg

It’s not pretty to have a cracked head

But if I don’t

I’m practically dead

As inanimate and detached as my wooden bed

To be raw is

Painful,

Ugly,

Messy,

But it’s rich with fee...

Read and leave comments (6)

🌷(6)

raw eggsmesscleansoulconnectintrinsicworldfreefreedomuniverseviewperspectiveexistentialgroundedcentredconsciousnessrawlifelivecontrolledwildsensory overloadpainfulemotionembracerealtruth

Let them Think...

Every day,

Travelling through Life,

We encounter Them,

Some, maybe true,

Yet many,

Disguised.

 

They have,

An ever changing mind,

Facing me,

They call me sweet,

Behind my back?

They say I'm rude,

They call me good,

Then say I'm bad,

They say you're the Best,

And then?

Nevermind.

 

Whatever they want,

Whoever they be,

Let them say,

W...

Read and leave comments (1)

🌷(4)

Heartbreak. Liesbad friendsChaos Life Judgement mental healthBetrayalsoulfoodsoulmindfulpositivehatefreedomdarkskin

Loses

Some loses are meant to be

For they pave the way for victory

We may feel sad and full of grief

But having faith can bring relief

The road to triumph is not always easy

We must persevere and stay busy

Though many hurdlles may we face

Our determination we must embrace

So let's not fret or lose our way

Our tomorrow will be a brighter day

For every loss brings a learning ...

Read and leave comments (2)

🌷(5)

heartsoulpoetryismy life

Fragments of a Soul

In pursuit of a better life

I refused to delineate boundaries

No bubble to protect my very essence from being frayed

My soul begins to rupture

Ever so slightly at first but slowly

I start to lose me at my very core

No longer recognising my own reflection

Surrounded by hyenas ready to snuff out my 

goodness at a moments notice

My laughs grow more quiet

The light in my ...

Read and leave comments (5)

🌷(7)

Nurturingsilencefragmentssoulruptureessence

Bigger than you

You should know better

Than to think you’re alone in this universe

You’ve seen breath come from nothing 

Animals evolve 

More complex than fathomable

Human species shapeshift and roam

With inventions inexplicable 

Grass, water, and life itself

Come to be 

And people like you 

Who all think different

And think they’re the only ones

Don’t assume you’re not connect...

Read and leave comments (1)

🌷(5)

CorelistenguidebeliefUnitedkismetwiseknowingSpiritsoulfaithconnectedlifeworlduniverseintrospectionthinkingmysteryalivealiensplanbiggerselfdiscoveryopen mindbig picture

Part of us

Something speaks from beyond 

Something writhes alive

In each of us

Something pulls and breathes

Beyond our touch 

They call it instinct

But it is magically distinct 

And can lead, lead, lead 

To something in your core

They call it power of the brain 

But it’s so much more 

It cannot be explained away 

It cannot be spoken out of existence 

They call it the mi...

Read and leave comments (4)

🌷(5)

Connectedalivediscoverykismetjourneyunitedwiseknowingsoulmindbrainworlduniversenaturespiritualpowerknowledgebeyondwiderspiritghostother beingtuitioninstinctidentitycoreguidelistenbelieffaith

One

I’m sorry to disappoint you

That I can be too sweet and so weak

And yet I can be cold and cruel too

That I can completely snap to my core

And morph into a creature of different sorts

I’m sorry that I’m not white or black

Or immaculate

Or of any matter 

For that fact

I’m not anything 

At all

Not wholly whole

You see,

Incompleteness 

Has been my superpower 

...

Read and leave comments (2)

🌷(5)

uniqueselfselfhoodidentityfreedomindependenceliberationgrowthhealinghappinessreflectionunderstandingmatureemotioninner strengthmove onsinglepersonhoodsoulmindgroundedspiritualhumanitypeoplebe yourselftruthvisible

Once again

Where was the fire that burned with in,

Water and earth would bring it to an end. 

Giving thanks for all she had,

The mystery of life were never bad.

Flying high like the eagle and hawk, 

She was wise never to get caught. 

Swimming thur the stars of change,

Everything could be the same. 

Better find the truth within, 

Tomorrow will be just like him.....

 

FIRE 🔥 

Read and leave comments (0)

🌷(3)

eyesspiritsoulenchanting

minus the soul,plus the body

my way or the highway
my way or the heartache
my way or minus the highway
my way or minus the heartache
minus the heartache,minus the highway
minus the soul,minus the heartache
minus the soul,plus the soul

minus the soul,plus the heartache
the mind,body is a plus of the soul
minus the soul,minus the body,plus the mind
plus the mind,plus the body,minus the soul
minus the soul is plus t...

Read and leave comments (0)

🌷(1)

poemspoetrymindbodysoul

'Fore he die

From those days of catching fireflies,

To the days of seeing how night lies.

Being the one around the center of seven,

Who knew he might be overlooken.

 

Soon the days turned into a mere trickle,

As the nights lasting for hours made him feeble.

 

As the stars passed by felt so much without any lace,

Thus the creation of a treasure chest took place.

Not really the trea...

Read and leave comments (0)

🌷(3)

eyesspiritsoulenchanting

sheltered soul

A sheltered soul is not soulful.

He’s hidden with worry and exhaustion.

Because the thought of pursuing is tiring,

Is damning,

Is embarrassing.

In a space that is too wide

There’s too much interpretation for the open.

So instead he closes himself softly,

Harshly.

He’s never been told.

He’s never been asked.

He’s never known that a sheltered soul is not soulful.

...

Read and leave comments (0)

🌷(1)

soulsoulfulmenwomenemotions

I see tomorrow, born from death

When death steal your tomorrow
leaving you with more questions than sorrows
What is life, so fragile, no time to waste
who am I, where do I belong, where is my space?

Memories painting a picture against the wall
trying to make sense of yesterday’s Fall
Some make you smile, some make you cry
there is nothing of yesterday to deny.

As time tempers the Mind and heals the Heart
the Soul is...

Read and leave comments (1)

🌷(5)

SeasonsHeartMindSoul

Burning Gold

you've ignited a fire

deep within my soul

that once was a blue ember

now burns gold 

Read and leave comments (0)

goldlighting firesoulembersdeep

I

Sometimes I think

Who I am but always I

Feel my existence.

 

Read and leave comments (0)

🌷(2)

Existencesoul

You Cannot Apply Makeup To Your Soul

Whatever my body, my soul is beautiful
Whatever my wealth, my soul is rich
Whatever the chaos, my soul is tranquil

Whatever the burden, my soul supports me
Whatever I lose, my soul will stay
 

Read and leave comments (5)

meditationshort poemsoulall that I am

PROMISCUOUS

Oh young blinded promiscuous one
In years you will wonder were your soul has gone
Your eyes they once twinkled brighter than jewels
Shadowed by other promiscuous fools
Unbeknownst to you these wild nights of fun
Are binding agreements that cant be undone
You give You away without a care
Without a thought your soul you do share
Oh vulnerable naive promiscuous one
Were have all your morals ...

Read and leave comments (1)

🌷(3)

Promiscuoussoul

Soul Searching

Craving escape

From infinity

It entwines

For a while

In a body

Exploring confines

Of humanity

Begging to break

Unknown boundary

 

Releasing timeless

Memory

Tilts on the edge

Of insanity

Won't rest

Till it is

What it's 

Meant to be

A Quest that confesses

Eternity

Read and leave comments (1)

Soulspirit

Drawn

I'm drawn
Drawn to you
And I don't  know why.
I'm spoken for but you're who I think about all night.

I'm Drawn
Drawn to you
And and your eyes
Like big diamonds when we played with Lucy in the sky.


I'm Drawn
Drawn to you
And your voice
We werent in the same room but I could hear you
And I got excited and I had no choice

But to be drawn
Drawn to you
And all that you are.
I ba...

Read and leave comments (0)

🌷(1)

soulattractionfeelingsrelationship

DON'T NEED

DON’T NEED

 

Have you given up on me have I given up on you

What is it we really can do as we look like fools

Can't see the future past my own dreams

But can you say your truly free

 

Don't need no blessed beads.

Don't need no lucky rabbit's feet.

 

Just need our leader's minds to be free.

Instead of thinking of a destructive ideology 

They have a death wish for...

Read and leave comments (0)

🌷(1)

FaithReligionsoulSpiritualitysuperstition

Ever Green

Your soul song is addictive, 
makes love evergreen. 

Peace flows through my veins,
amidst a world gone mad. 

Play on, in the misty starlight 
of my mind. 

https://youtu.be/q_y_gBz-74o

Read and leave comments (2)

🌷(3)

blueslovemusicpeacepoetrysoul

Thundersoul

If you could compare my soul to anything in nature

I’d say it‘s like a thunderstorm

people have mixed feelings about it

there are positive and negative feelings involved

some fear it for its destructive potential

some admire the lightning show

 

tension holds it together

that it’s trying to release

an inner state of unease

it’s contrary in all of its parts

the heat...

Read and leave comments (2)

🌷(5)

Inner StrugglePurposesoulthunder

REVLUTIONARY SOUL

There is more then what you see
More than what you are told to believe
You can't have what you already own

Take back your peace it is more than anything
Take back your love there is beauty in every one
Take back your purity the way you live will make you free

Revolutionary soul
Much more than owning all the gold
Revolutionary soul
Much more than fame or what you think you know

A ma...

Read and leave comments (0)

political poemsoulrevolution

Soul Songs

Your poetic words 

bring comfort

my mind

cannot comprehend. 

Floating in the

healing waters

of your soul, 

is my favorite pastime. 

Two stars colliding,

creating a kaleidoscope 

of time. 

In the space 

of your song, 

life is sublime. 

https://youtu.be/_256xd9N27o

Read and leave comments (5)

🌷(8)

lifemusicPoetryrelationshipshealingsoultimespacespirituality

The Quiver Of Fond Lips

I never used to look at people's faces

My body language was out of kilter

Then I met you and saw the world

Through a life-changing filter

 

The thing about you that gets me

Is the quiver of merciful lips

On a mouth adorning the face 

That leaves my heart in bits

 

The quiver of fond lips cant be beaten

It makes my soul leap and rhyme

Should yours ever stop quive...

Read and leave comments (3)

🌷(3)

quiverlipsmouthheartsoultime

Sunrise

May peace be with you,

the whole day through.

 

May aches and pains

sail away with the blues.

 

May sunrise open your eyes, 

experience make you wise.

 

May your soul find its way home

on the wings of love. 

 

https://youtu.be/1oCksFrWMHY

Read and leave comments (7)

🌷(6)

lifelovemusicsoulpeace

wanted

wanted to cry,

but smiled,

 

wanted to talk,

but stayed silent.

 

wanted to feel happy,

but endured all the pain.

 

wanted to live,

but died.

 

          k.d

 

Read and leave comments (1)

🌷(3)

painsuicidedeathpoetrysoul

Fandango

A magenta sky 
greets my morning sigh.

Another majestic day, 
lost in the minutia of life.

Shoulda, coulda,woulda,
paralyzing dream sabers. 

Distractions abound.

Download another book,
refresh the poet's page.

Escape, behind a waterfall
of tears.

Long nights,
paved years. 

Fandango memories
sustain me. 

Resilience 
prevails.

Dry your eyes,
face your fears.

Wr...

Read and leave comments (0)

🌷(1)

depressiondistractiondreamsfaithhabitslifelonelinesspoetrypoetsprocrastinationrelationshipsResiliencesadnesssoulwriting

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

🌷(2)

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac

Artists & Critics

She doesn’t sing to win awards,

she sings to breathe life to her soul,

connect with spirits tuning in,

let them know they are not forgotten. 

 

She knows she will have critics

that judge her art lacking. 

Their negativity is nothing she hasn’t

overcome from herself a million times

on her rocky road to freedom.

 

She smiles as the ivory tickles her left palm,

sur...

Read and leave comments (2)

🌷(7)

artistsconfidencecriticslifemusicnewspassionpeacesoulunity

IS OUR FATE - ALEXIS KARPOUZOS

Poetry and creative writing by the philosopher and author, alexis karpouzos.

Actress : Martha mourouzi

alexis karpouzos on Amazon

alexis karpouzos on Goodreads

alexis karpouzos on youtube

alexis karpouzos on spotify

Read and leave comments (0)

poetrymeditationmetaphysicsphilosophyspiritualityconsciousnessinspirationlovebeautyartnatureuniversespiritsoullifeeducationsciencesitllnesspeace

I MET A WORD - ALEXIS KARPOUZOS

Poetry and creative writing by the philosopher and author, alexis karpouzos.

Actress : Martha mourouzi

alexis karpouzos on amazon

alexis karpouzos on Goodreads

alexis karpouzos on instagram

alexis karpouzos on twitter

Read and leave comments (0)

poetrymusicartmeditationmetaphysicsspiritualitylovelifebeautyconsciousnessnatureuniverseeducationselfgrowthpeacestillnessinspirationspiritsoul

I SAW A ANGEL ON HEAVEN - ALEXIS KARPOUZOS

Alexis karpouzos poetry and creative writing.

Actress : Martha mourouzi

Alexis karpouzos on Amazon

Alexis karpouzos on Goodereads

alexis karpouzos on instagram

 

Read and leave comments (0)

poetryspiritualitymeditationmetaphysicsphilosophyartloveconsciousnessawarenessbooksspiritsoulbeautynatureeducationscienceuniversestars

Disappearing Ink

You pen beautiful poems,

revealing hurts, worries,

secret desires of your soul.

Dancing on high wires,

creating cosmic alchemy,

then your words

are gone in a blink.

You must be using

disappearing ink!

https://youtu.be/lpsThfIqp18

Read and leave comments (4)

🌷(5)

alchemychemistrycosmic beingPoemspoetryrelationshipssoul

Savaged Soul

If I knew your poetry would suddenly 
disappear, 
I would have memorized 
every poem,
to comfort me
when I feel alone. 
Your words help heal 
my savaged soul.
I'm sad you had to go.

# # #

https://youtu.be/OeP4FFr88SQ

Read and leave comments (8)

🌷(4)

censorshipdeathdepressionhealinginjusticelifelosspoetryrelationshipssoulwordswriting

Arrogance Immunity

Here comes arrogance again,

slipping into our conversation

like bacteria on a sneeze,

threatening to strangle

my humble light of being.

The challenge is to continue talking,

without letting it infect me.

My soul gives yours a wink,

understanding that compassion

is the antibody. 

# # #

https://youtu.be/z-NgDbK9N6g

Read and leave comments (5)

🌷(4)

arroganceforgivenessimmortality.immunitylifelovepainrelationshipssoul

sea to song

effective myth, metaphor, & mysticism transcend

semantic efforts to articulate dynamics erupting

dreamlike amidst more trusted, linear conceptions

of reality, imagination, experience, & being

 

by presenting arrangements so engaging, uncannily

familiar, irreducibly insightful, idealogically slippery,

that the foamsplash suddenness of its crashing

across a previously unnotic...

Read and leave comments (0)

🌷(1)

metaphormysticismmythoceansoulspiritwhale

WHERE IS THE MAGIC? - ALEXIS KARPOUZOS

Where is the magic?

We all start out knowing magic.

We are born with hurricanes and whirlwinds,

oceans and galaxies inside us.

We are able to sing to birds and read the clouds

and see the destiny in grains of sand.

But we have forgotten the magic

and we feel without compass, alone and desperately,

only selfishness, only pain, fear and darkness.

But, magic of love has nev...

Read and leave comments (2)

🌷(5)

lovebeautyharmonystillnessfriendshippeacefulsilencelightlifeheartsoulpoetrywritingspiritualphilosophyEducation

Show more entries …

This site uses only functional cookies that are essential to the operation of the site. We do not use cookies related to advertising or tracking. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message