POEM (Remove filter)

The Evo’s Gift - Forgiven Sin

The resounding sins, of

many echo through

their etheric karma

manifesting the

good intentions, of

Personal Truth

 

at the end of the day the air waves:

find their way back home,

when the sun goes down, and

the lights go out at night

 

lightning never strikes the same place twice

however, once in a while you wonder…How? 

 

In the world we live in —

Th...

Read and leave comments (0)

🌷(4)

christmashollidaylovepoetrypoempoetpoemsnaturegodspiritualgoddessspiritualitymetaphysicsmetaphysicalocculttravelfashionmodelmakeupwedding

through the eyes of a stranger


 

Through the eyes of a stranger,
I walk the crowded streets,
My thoughts hidden behind
A façade of indifference.
Always writing under breath
Each step the rhythm of a song

I listen for the murmurs,
The stories left half-told,
And with borrowed breath,
I weave their words into verse,
A silent chronicler,
Of lives intertwined.

Beneath the surface of each face,
A universe of fe...

Read and leave comments (1)

🌷(8)

poempoemspoetpoetspoetrypoetriespoeticspoetinglifescope

Repeat

It's morning. 

 

The peace I had is suddenly gone.

 

Creeping into my head is the anxiety and sorrow I always have.

 

Why couldn't I have slept longer?

 

Why do I have to wake up?

 

The day is too long,

 

The minutes feel like hours

 

The hours feel like days 

 

The days feel like weeks.

 

I can't stop this feeling. 

 

Feeling of grief- w...

Read and leave comments (2)

🌷(4)

repeatcyclefalse hopehopelesspoetrypoemsad

Labelled

Becoming slowly unrecognizable to yourself and others
Feelings and thoughts take
a hold, giving you the shudders
Memories and emotions that seem to flood your heart
Faces and places making it hard to know where to start
Decisions throughout the day, waiting to be made
Resting again in bed where it all just seems to fade
Urges of wanting help yet not knowing what to say
Triggers causing you...

Read and leave comments (1)

🌷(7)

poempoetrywritingmentalillnessmentalhealthrhymerhyming

Valentines

Taking time out on a couple of dates for one
May seem lonely or anti social for some
But having space to yourself - mostly all alone
Shows a few changes that you have outgrown
Valentines Day - being a special one for lovers
A time of anticipation and kindness for others
Loving yourself by being your own best friend
A journey in itself which doesn't need to end
A card, message or present yo...

Read and leave comments (0)

poempoetryromanceromanticvalentinesdayvalentineswriting

Valentines Day

Dressing up, styling hair, feeling fine
Card and presents, wait to be opened, all in a line
Roses, chocolates and bottles of red wine
Celebrating Valentines Day, its just a matter of time
Happiness shown, whether it be rain or shine
Cupid wasn't so stupid, sending his arrow as a sign
The restaurant booked, we drink and then we dine
Thinking that when we met, he must of made you mine
More s...

Read and leave comments (0)

poemspoemwritingvalentinesdayvalentinesromanticpoetry

Spring

There's something about this season, Spring
Waking up to birds as they, sing
Trees and its blossom show subtle, pinks
Clouds and rain, for thr earth now drinks
The sun reappears, having such a glow
As if it were trying to say, hello
I go to the garden to walk around
To see what other things are found
Butterflies with their colorful wings
How this season holds such beautiful, things.

Read and leave comments (0)

poempoetrywritingspringrhymerhyming

Lockdown

Going to bed then waking up late, what lies ahead?
We ask you fate
Jogs in the winter sun around the area,
Becoming healthy - losing weight
With hope in the vaccine and wanting to be immune
We look to this date
Remembering things of the past, finding comfort
Talking to a mate
Thinking what we have done and future plans
Good and bad times we know await.
 

Read and leave comments (0)

poetrypoemwritingrhymelockdowncovid19

Separation

No matter how much the shouting, its the inside worth counting
Never mind harsh words of a person, their actions could never worsen
Others with a listening ear, may take away the fear
The unknown goes on behind closed doors, hiding all the flaws
Love seemed a while away, yet so did the other day
Fondness comes after the trouble, back to how things were, a couple
Smiles are exchanged, somehow...

Read and leave comments (0)

poempoetrywritingliferelationshipsrelationshipsending

Misfortune

Letting someone else's light shine brighter than mine, isn't such a prideful crime,
I should listen to what people have to say, to have the attitude of 'come what may',
Speaking my mind being always kind, the truth is what I then, shall find,
I think, I think, I think too much, I would rather not about such and such,
I learned to appreciate from a distance, family and friends, I love within an...

Read and leave comments (0)

🌷(1)

poemwritingrhymepoetryreal life

How much longer?

Still, as I'm placed gently, carefully, so I may not spill over, 

Dial me up to medium to simmer the symposium that's eager, 

Waiting patiently for my bubbles to burst, to stimulate my undying thirst.

Read and leave comments (0)

🌷(5)

lifetransformationpatiencepoemshort poem

Written in Stone

an epitaph
covered in overgrown grass
numbers and a letter encrypted,
written to the deceased,
for only those who knew him
you’d truly understand

Read and leave comments (0)

🌷(4)

familyfriendsdeathlovegodspiritualspiritualitynaturemetaphysicsmetaphysicaloccultpoetpoetrypoempoemswriterwriting

Hot Spring

the plumes of a caldera,
and the dark clouds,
sun overshadowed,
at its core a scalding heat turned colder
because of similarities
shared this simile
for the changing of seasons, anew
an unforgiven embrace

Read and leave comments (0)

beachsummerseasonspoetpoetrypoempoemswriterwritinglovenaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Table Manners

he wouldn’t let us leave
without paying,
for our meal

had to-go

then bantered with them
and, you ordered to make him take it back

the whole ordeal was a real headache,
I could feel tension in the temple,
and had to meditate, to
clear my head and relieve the stress

I wanted to post a pic of my meal,
but it was almost traumatic

Maybe, I’m just being over dramatic?

Read and leave comments (0)

dinnermakeuplovepoetpoetrypoempoemswriterwritingnaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultart

size them up

had me my hand me downs
and, we all know too well known
if the shoe fits wear it

nicest stuff is worn out and she wore my XXL shirt around the house
her chores, get done…
one bra in the wash and no panties on

The first steps
commemorated with expensive shoes,
soles being broken in,
a mash of burning glass,
molten sand and in it,
it’s silica content

Read and leave comments (0)

🌷(7)

cinderellaglassartworkartpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovemakeupfashionmodel

approach with caution

veered off, routine stop, in the shoulder…
looking over your paper work,
keep your hands on the steering wheel,
“I’m not going to ask again”
repeated offenses
respect my authority

police officers
a ford mustang and dodge charger

government funded electric vehicles
take a look inside the hood, it
purrs like a street cat with a scratchy throat

cut the lights on and off
I’m just try...

Read and leave comments (0)

USApolicecarpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovecreativeartartwork

phishing

attempts
online attachments
“Hooks & Worm” viruses
hosted— a parasite

on the web
spider crabs
In their net

Read and leave comments (0)

funfriendsbeachsummerpoetpoetrypoempoemswriterwritinglovequotesquotenaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultinternetviral

Surprisingly Secure

Today I looked at my mirror image and didn’t turn away.

I scanned my face and physique without any harmful thoughts.

Taking an interest in the fabric that I wear, not the skin beneath it.

Seeing myself as a complex creature, not a simple sex doll.

Admiring the way my hair falls around my face and my necklace matches my earrings.

How my blue eyes stand out submerged in eye shadow and...

Read and leave comments (1)

poemSelf-esteemmentalhealth

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(6)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Flowers of Misfortune

In the silence that resonates,
a lament of absences,
the flowers bloom in the shadows,
whispers of a life that fades away.

Eyes searching the horizon
for a trace of hope,
but pain, like a poem,
is sculpted in the words of the day.

The city is a labyrinth of steps
that reflects solitude at every corner -
laughter dissolves in the wind
like falling petals,
disguised in the chaos.

...

Read and leave comments (1)

🌷(4)

flowerseyeslifehopepoemwordsdaylovelostyesbeautiful

Black Fire

Everyone has a fire in their soul

A bright passion that makes them whole

An urge to follow like a fool

A desperate need to fulfill no matter how cruel

 

A bright spark in their eyes

A light that never dies

A wonderful dream that never lies

A reason to get up and rise

 

A star in their hearts to answer their wishes

A burning desire inside their chests

A cheery pe...

Read and leave comments (1)

Firepassionlifepoemwriterpoetsad poems

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

Pain Relief

When will it go away?

 

The pain in my chest

 

Pain in my stomach

 

Pain. 

 

It’s repetitive and never stops

 

It creeps up on me like bugs

 

Stings like a wasp

 

Bites like a mosquito

 

And leaves, taking a small part of me

 

Some say it’s a part of life 

 

Maybe I don’t want that

 

If this is life 

 

Maybe I don’t want any p...

Read and leave comments (2)

🌷(7)

painlovefriendshipreliefpain reliefhoperegretlossfaithpoetrypoem

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

We Took a Wrong turn

You know what ?
they say,
three lefts make a right.

I’ll go ahead
and, uh…
double back around

now, where were we

we’re here

Where?

There.

well.. then,
why didn’t you just tell me that in the first place

Read and leave comments (0)

streetcartravelnaturelovepoempoetpoetrygodspiritualspiritualitymetaphysicsmetaphysical

Dead End

you need to
... stop
ignoring ...
the warning signs to
turn around your life

Read and leave comments (0)

carstreetlovepoempoetpoetrynaturegodspiritualspiritualitymetaphysicsmetaphysical

Bullet Points

This just in
The faulty firing pin — from a fire arm
had become dislodged
effectively,
causing it to misfire

very briefly …
in acceptance of all responsibility
the city-state committee
has sent a representative
that will be answering questions

now… back to you

in other news
we have a sunny forecast

there’s a color shader
right there, on
this heat map
that has an infrared si...

Read and leave comments (0)

gunsafetyfirearmsusalovepeacefreedomcrimemetaphysicsmetaphysicalspiritualspiritualitynaturegodpoempoetrypoet

Eyes on Me

I don’t want to be seen

 

I don’t want to be perceived

 

I wish I could go anywhere and be invisible.

 

People are everywhere

 

Eyes are everywhere

 

They’re all living their own lives but why do I feel as though mine is being watched?

 

As though they’re looking for a mistake in me

 

Is my hair messy?

 

Is my outfit mismatched?

 

Do I walk wei...

Read and leave comments (3)

poetrypoemlifeeyesanxietyhelpdepression

Doctor's Visit

I am a silly boy 

Today it crept down my skull 

and trickled across my collar

and filled my arms and groin 

with heat and blood and sparks 

I panicked and squirmed and screamed 

I had no control, 

asked my doctor to help 

He told me, with a patronizing paternal smile, 

that I was feeling 

happiness 

Read and leave comments (0)

🌷(6)

freeversepoem

in the darkness, lights

I was ready made for grief.

to live an ode to a common thing,
     this elegy to peace.

and on the days that I feel nothing,
     I torment the stillness behind my eyes
because feeling is proof of living.
and I so badly want to be alive.
     to dig deep in the scar garden,
     to excavate my hollow pit,
     to sow a lifetime of memories
     of being just out of reach.

it is my...

Read and leave comments (0)

🌷(1)

poemofthedaydeathsadaddictionpoetrycommunityscarsgriefpoem

Specter

I cast away my ego just to see you smile,

Only to watch you vanish like a ghost in the night.

That specter still haunts me,

Each time I remember you,

Stealing my rest.

Surely, it lingers to teach me a lesson.

I hope it’s something valuable,

Something to make me stronger,

To help me understand this abandonment,

And fill this void inside.

 

I am not alone; your spect...

Read and leave comments (0)

🌷(6)

poem

Loneliness

Loneliness is feeling isolated even when someone stands beside us,
A companion who shares our days but leaves our soul empty.
Surrounded by familiar faces, we doubt if they truly love, value, or respect us.
When our days feel like wasted moments, irretrievable and lost.
When dreams and goals fade into “I’ll never succeed,”
And we’re consumed by the fear of being the failure we see ourselves a...

Read and leave comments (4)

🌷(5)

lonelynesspoem

B&W

I keep seeing life in black and white,

Unable to distinguish between reality And the fictional world I built in my head,

Like a mental architect,

Shielding myself from invisible threats,

That silently harm, That suffocate,

That make you believe in constant dangers that don’t exist.

The uncertainty of the future, Regrets of the past,

Loneliness, beautiful loneliness, Visiting m...

Read and leave comments (2)

🌷(4)

sorrowpoemdesolationabandoned

Spiritual Anima

human nature and
sympathetic sensitivity

parasitic

thought forms and will
manifest in woman and child

more so

than the inward hatred from a negative mentality

Read and leave comments (0)

animalnaturespiritspiritualspiritualitywriterpoempoetrypoetlovegodmetaphysics

Déjà vu & Phantasmagoria

— Recurring

crime seen in your eyes,
reflecting - eyelids
singed… deep, froze
and framed with pain
the negatives
of a photographic memory,
an outlook not unlike,
questioning, asking myself
what have I done?
what am I doing with my life?
what could I have done different?

Read and leave comments (0)

🌷(1)

crimethrillerlovepassionpoempoetrypoetwriternaturegodspiritualspiritualitymetaphysics

traffic & drugs

cats pests and insecticides
labrador dog breed
strands of
grass and dirt weed

Read and leave comments (0)

🌷(3)

cheech and chongmoviescriptpoempoetrypoetpoemslovenaturemetaphysicsweedcannabisdrugsgodspiritual

11:11

In the first second
infinite sensory overload
will begin, download it
and then this
thought process …
it is up to you to utilize
the central nervous system’s data

our own eye of the storm
strike like
lightning …
fast reflexes at the hands
of centered command

Read and leave comments (0)

11:11timeclockmagicspiritualnaturemetaphysicsgodpoetpoetrypoempoemswriterlove

reincarceration

serving consecutive life sentences
three meals,
the confines of jail time
three strikes,
and they are never letting you get out
they throw the book at you
like a caged animal
preying,
...as it lands on a page that says
a message from god
sins written on — listed off, and then
sent across the hall to your distant friend again

a life of recycling license plates
crime pays for the chip...

Read and leave comments (0)

U.S.AUSA4th of julypoetpoempoetrypoemsnaturemetaphysicsspiritualgodfireworks

Clothing Line

cut from a different cloth
dyed in the wool you pulled over your eyes

you made your bed now lie on it
tomorrow
is a wonderful day to die innit

I dress my wounds
and wear my heart on my sleeve
with cuff links & fingers crossed

Read and leave comments (0)

poempoetpoetrypoemsnaturemodelclothingfashiongodspiritualmetaphysics

Pandora's Box

Thought,

outside the realm of possibilities

Chaos …

beyond belief:

and great faith.

Read and leave comments (0)

greekgodspiritualmetaphysicsnaturegodpoempoetrypoetpoemsmythology

just walk away

pack your bags
and
go get ready

to walk the walk
through the traffic
of differing directions
wave down the runway
and remember…
never, look back

Read and leave comments (0)

modelingbeautyfashionnaturemodellovegodspiritualmetaphysicspoetpoempoems100 best poetry blogs

Divine Intervention

where did I put those car keys,
I think I have had one too many,
loss of memory —
and this
drug habit
has me... grabbing my head
trying to
get a grasp on my own sanity

Read and leave comments (0)

drugsalcoholsoberlovegodspiritualmetaphysicsnaturepoetpoetrypoempoems

questioning my destiny

In my study,
the test subject,
had to have
strands
of  this
genus’ genotype
“A” and be
exhibiting these abnormalities

Read and leave comments (0)

schoolNaturelovepoempoetrypoetmetaphysicsspiritualgodbeauty

Soul trickery

Two different souls

Two independent individuals

Two souls brought together

That were supposed to be equals

 

Two souls that found

Understanding on the other

Or that's what I though

Because I was only just fodder

 

I was happy to talk

I was happy to be me

I was happy for the future

That i wanted to see

 

I invested myself

In a possible relation

Try...

Read and leave comments (0)

🌷(1)

loverealisationpoem

Poem: Summer..

The scorching heat of Sun,

children playing in ponds and having fun.

The temperature may rise,

and if you are enjoying it.

You are also wise.

That is Summer!

 

The feel of blowing wind,

And because of the sweat,

our bodies get thinned.

and my sister’s flying hair.

And if we go out too much,

our skin gets dark from fair.

That is Summer!

 

In deserts it i...

Read and leave comments (0)

🌷(8)

poempoetrysummerNaturelifeStudent

Project Astral

remote viewing
a program,
telepathic visionaries
— channels
seers…
seen in a screening
recorded and reviewed

Read and leave comments (0)

🌷(3)

lovepoetpoetrypoemnaturegodspiritualityspiritualmetaphysicsoccult

Ghost Writer

dispelling of a curse
wards off
unknown entities
who try their hand at automatic writing

ghosts, haunters, 
“en animant” in specters
instruments crescendoing
as the light abandons us

no ones home,
signs that say to go away

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualspiritualityoccultmetaphysics

Quantum Leap

displace - out
from this world
but,
not of it 

In finite spaces where mathematics add it, if
nothing changes places with one thing
And, then... again
this singularity is the black hole devouring our
multiplication - signs of the times
how the tables have turned
one number
spiraling out of control
Oh, flower of life...

Read and leave comments (0)

🌷(1)

poetpoemlovenaturespiritualoccultmetaphysicsgod

Sweet Nothings

Queenship and Kingsman
The terms of endearment
scroll …
And, read through it

Except,
what’s in the fine print …

Maid of Honor …

If you would,
please …
As the left hand of the queen
swear your loyalty

Read and leave comments (0)

🌷(3)

poetpoetrypoemlovenaturespiritualspiritualitygodmetaphysicsoccult

Symbiosis of Broken Hearts

What is love?
Besides “A”
— a couple of
vowel sounds,
between U & I

ouïe?

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualitymetaphysicsmetaphysicaloccultspiritual

Now or Never

Who said now or never?

Maybe that was someone clever,

What if they had seen the future?

That would have been hell of an adventure.

 

Wonder why they asked to do it now?

Well, the time in future may not allow,

Why not have a try at it for once?

It may uncover possibilities, revealing new fronts.

 

How will this help you to not be mistaken?

By not regretting the road...

Read and leave comments (2)

🌷(6)

contemplationpoemthoughtful

Should This Night End?

Woke up in the middle of the night 

It felt like sitting on one of those chairs in the mountain campsite

But it’s just my bed, right?

 

Have been through this illusion a couple of times

Putting on those earpieces every night

Listening to The Neighbourhood’s rhymes

Sending those chills down my spine

As i go on with the flow every time

Man, isn’t that awesome, right?

 

...

Read and leave comments (1)

🌷(5)

poemillusionreflectionsdreamscape

The First Try

Started writing this piece of poetry

Wondering how to go with the flow

Lots of thoughts in my mind

Can’t wait for all of them to grow

As i now happen to grind 

How it shall go? I don’t even know

 

In the pursuit of getting it together

Those words went away from my mind for sometime

But it feels like forever

I wish i could write like her

For how she puts it altogeth...

Read and leave comments (3)

🌷(8)

poemfirsttryinspire

Star seeds ‘n’ the Cosmic egg - of life

Dewy lotuses, 
grow in the dark -
creating an entangling —
Flower of Life …

nature and everything — we know — has its roots
on the grounds of truth
indeed…
every family tree,
needs...
a tree house.

Habitats for Humanity  

There is a lone wolf
which is black,
and blue,
in the eyes :
whom sees the world differently
depending on —
whether or not you’re 
— on his or her good or...

Read and leave comments (0)

🌷(3)

birthdayhappybirthdayoccultmetaphysicsspiritualmetaphysicalnaturelovepoempoetrypoetspiritualitygodtruth

Miscellaneous

Almost they spell me

I switched my focus towards him in an instant

Literally impossible to walk away.. although

I know there's snakes in the distance

 

Rats they scurry and take ..calculated

Even rats have a system

He says I love you ...It's reciprocated

Intrusive thoughts making me a victim

 

When did love start hurting

we combined souls through trust

Lower fre...

Read and leave comments (0)

🌷(6)

Miscellaneoustrustpoem

i miss being your daughter

we were close when i was little

you called me your sugar plum fairy

sat by my bed when my dreams were too scary

I didn't know then that our relationship was so brittle

 

you have mixed feelings about your own mother

maybe that's why you act the way you do

you rip me apart and then try to patch me up with glue

we both know you wouldn't ever do that to my brother

 

you ...

Read and leave comments (1)

🌷(6)

mommommy issuessadteenage girlgrowing upchildhoodpoem

For You, Wherever You Are

It was on my first of many elevator rides 

up from the basement floor

I met a woman with short, red hair and a leather jacket, 

who I only ever saw 

just this once. 

 

I don’t know whether I ever responded

when she spoke to me

or to God

or to the elevator door 

 

saying:

three years ago, now,

they had given her six months to live. 

 

saying:

three ye...

Read and leave comments (1)

🌷(5)

cancersurvivorhopepoem

take the wheel

And venturing out
as an artisan model aircrafts
... enthusiast
is a larger than life recreation
to somebody
who
fell in love
with
Amelia Earhart's
figure 8

Read and leave comments (0)

naturelovevalentinesvalentinesdayspiritualspiritualitypoempoetrypoet

makeup sex

Ugh
Beauty standards ...
 
makeup your mind
you said you'd be ready
an hour past ...
you haven't changed at all
I'm leaving you
 
While i tease your hair,  suck it up
I'm head over heels in love

Read and leave comments (0)

beautymakeuplovenaturespiritualspiritualitypoempoetrypoetvalentinesvalentinesday

Road Rage

The bike are riding two by two 

Hurrah hurrah 

The bikes are riding two by two 

Hurrah hurrah 

The bikes are riding two by two 

It’s the Highway Code, but I own the road 

So Ill just keep driving on 

 

The bikes are now riding three by three 

Oh shite oh shite 

The bikes are now riding three by three 

Oh shite oh shite 

The bikes are riding three by three

As ...

Read and leave comments (3)

🌷(4)

roadragedrivingbicycleshumourfunnypoemsong

The Greatest Trick The Devil Ever Pulled is convincing the world he doesn’t exist

The greatest trick the devil ever pulled 

Is making the world believe he doesn’t  exist 

 

I don’t know why but I don’t agree 

Let me explain I have an idea you see 

Conspiracy theories is fuel for his flames 

Brexit, traffic jams and gossip entertain… 

His hoards and minions cheer and go wild 

All waiting for the day that Johnson’s defiled 

With a rod up his buttocks fo...

Read and leave comments (0)

devilhumourpoliticsrudepoembrexit

the Good Book

generational forefathers
bore thine
fruits of their labor,

to an heiress

Oh, the burden
given to this poor mistook child.

the Fall of man—after death
40 days and 40 nights,
If we were to predate the Gregorian calendar
… spring too,
life—before Christ—dark
and light archangels
would earn their halos
from Helios through
sun worship,
during the 7 Days of Creation,
summer was mad...

Read and leave comments (0)

🌷(3)

godspiritualspiritualitynaturelovevalentinesvalentinevalentinesdaypoempoetrypoetwriterart

This site uses only functional cookies that are essential to the operation of the site. We do not use cookies related to advertising or tracking. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message