Donations are essential to keep Write Out Loud going    

Popular last 30 days

love Life depression Nature poem loss War sad death addiction

Popular last 12 months

love poetry life poem nature death hope War loss poet

Love (Remove filter)

It's easier not to love

Sometimes it’s better when you don’t have to love,
Easier when she just doesn’t give a fuck,
She said I didn’t play the pornstar, and that’s a good start,
But tonight we’ll agree neither of us have a heart.
And like a weight that’s been relieved,
Like new lungs still waiting to breathe,
There’s no pressure, or so I made myself believe.
So in the morning you can just get up and lea...

Read and leave comments (2)

rhymelovesexlife

The Penultimate Battle

It’s has always been easier to slay us

With your obedient insecurities

Cheerfully devoted to poetic doom

You speculate, create and anticipate

A wheel of fortune that spins in your tomb

Lashing and flaying against happiness

You claw and spit against the lid

Of exhausted insight and recognition

Crying out against comprehension

With a scream of lies and unravell...

Read and leave comments (1)

lovelove poetry

Thoughts Are Things

Thoughts are things

Not things that disappear when your mind is closed

Or a wave of energy that fades away

Oh no, thoughts are things

They’re here to stay

 

So when I see you face to face

I take that vision place to place

And when I’m tired and sleeping fast

That thought is with me in my dreams

Because thoughts are things

They’re here to stay

 

...

Read and leave comments (2)

thoughtlove

Untitled

Withered flowers fastened to a wasting bench,
Its plaque and pickled paint are weathered long.
The buckled slats curl flecks on harshest winter's freeze.
Where age defies intent to which it did belong.

As passers-by whom in their daily cues entrenched,
They, wrapped in woolen shields, look blindly on
And notice not the broken petals on the breeze,
Nor sense the echo of a parted...

Read and leave comments (0)

lovesoulsadnessdeathlossMemorialpoem

the Bright Side to Each Other's Moon

 

12/1/12

 

Ripples in the water. Forever bouncing. The transformation from Sea to Land. The water. a Constant Surge. Pulsating Tides. those Building Blocks. Keeping a foundation grounded. The inspiration behind the pen.

_______----_____________-----_____________----_____________----_______

Are we all just words in a pictionary born again to have meaning? My reality appears vastly d...

Read and leave comments (0)

saptruthLovebuilding blocksmississippi riverdancewrite2217Timmy MitulligreatquestionfunnelMNtalitycloudsstormbaked thoughts

Nesting

Clearing drawers

On that side of the bed

And putting things back again

 

The bathroom isn’t done

Fuck.

 

The garage isn’t cleared

I hope his car fits in

 

Big lack of wardrobe space

Fuck.

 

He has got so many clothes

Where would they go?

 

It’s his wedding anniversary next month

So what kind of new madness is this?

 

Ho...

Read and leave comments (2)

lovelove poetrylove poem

I Miss You

Hello there,

Angel from my nightmares.

Devil from my dreams

a grey spirit that weaves

its way through my existence.

What a Dementor does to souls

or a Dalek to a human heart.

 

Even a superhuman heart

can break.

 

Just ask Logan,

a force so strong

a returning phoenix

could not reignite remnants.

 

I miss you.

Whatever yo...

Read and leave comments (0)

lovelossinternetfeminismtumblrradfemfeminazitrutheternitymissyouherhimthemtogetherforeveralonesilentangeldemondevilsatanreligionzealotryKingdom HeartsDoctor WhoDaleksX-MenLoganWolverinePhoenixJean GreysuperheromutantsuperhumanTime Lordghostmemoryspirit

One for the couple at the back

Reflected in my beer

A face appears

That I haven't seen in years.

 

Says he's just had his heart broke,

So I offer him a smoke

And an attempt at a joke.

 

Through ambient amber hazes

We discussed the settled dust

And how we'd performed on our seperate stages.

 

How he'd backflipped

Into a basket,

That became a funeral casket.

 

I s...

Read and leave comments (2)

loverhyme

Suspicion

 

Your mood swoops up and down. A zigzagged bat to my twilight 

you forage on blood and nectar, then fly home again to roost.

Slowly stealing our sleep and holding our dreams apart, a deity

of doubt covets the forthcoming clamour of kitchen sink drama. 

My credence that I love you with a passion she cannot match,

with a depth she cannot reach, with a strength she cannot ...

Read and leave comments (2)

lovelove poetry

March Is In Love

 

Winter was admired by March all night

He walked with her along the snowy paths

But her daughter captivated his sight,

With her he dreamed to have the baths.

 

In ruffled feelings he came back in the mornings

Becoming tipsy of the night’s vision.

He didn’t care about any warnings.

And his fate had quite another decision.

 

His darling was the spring ...

Read and leave comments (0)

springlove

Equinox

“I love this bed” you sigh. Half clambering, half enticing.

Socks fly chaotically towards carefully folded suit trousers

on the stair banister outside our door. Seductively deluded

domestic comfort. We mock the coupling joggers sweating and panting.

Beating the towpath in desperate lust for a BMI of whatever. We know

a much better way to keep the pounds off by keeping poundi...

Read and leave comments (2)

lovelove poetrylove poemerotic poetryerotic poem

minnow

 

the water is cold

as I dip my hand

 

silver-eyed -

a minnow

approaches

 

my fingers open

my hand

is a cup

 

the minnow

visits

 

the minnow

means

everything

to me

 

magic and fleeting

a mercury being

the whole world

echoing

within

his scales

 

 

 

Read and leave comments (5)

love

I'm to leave now

 

By: Ali Taha Alnobani

I'm to leave now

A tall ghost is carrying my bag

A long street is walking behind me

A mad merchant bought my smiles

And no water to renew the dusk

I can't have my step begun

Even if the rain washed my tears

***

I'm to leave now

Can I have a deep look at your eyes?

Can I take my dreams, your smile

And my dried red rose?

...

Read and leave comments (0)

farewellgood-byevaleValentinesValentineValentine poemleavingshe leave me small giftslovesad loveromantic distance love dan hookslove makingLOVE SONGfalling in lovelove and time passinglove passionfire flesh love passion obsessionlove sonnetLove lostlovedlove is deadLoverslove endingThe Passionate Lover To An Artisttravel love thoughts musing

The Strawberry woman

By: Ali Taha Alnobani

I know, strawberry has charm

But this time, it is a moon in spring temples

A Call beaming in the morning

And a mascot painted on god's arm

Your lips proclaim another speech

About angels ceremony for love

Which conduct there in paradise

Over fire, under ice

Near the golden beach

That nobody can reach

***

I know strawberry has...

Read and leave comments (0)

beautifulbeautywomanSpoken Word poetryloveparadisepoetrysleeping beautycharmpaint

Fusion

By: Ali Taha Alnobani
 
He was lying on the grass
Looking carelessly at his watch
He needs to relax
But a voice is slamming his head:
Tick … tick
Seems saying: life is just a trick
***
He took a picture out of his pocket
Ripped into small pieces
Paths and routs
Plants and shoots
Telling the happiness rare story
About the unlucky traveler
...

Read and leave comments (2)

love and time passinglosssad poetrysadnesssadfusionlovelovedlonelinessgypsyLondon

Sofia's Masterpiece Story

By: Ali Taha Alnobani
© 2011 by Ali Taha Alnobani
A lot of people I knew
Tried to cross long bridges
Sofia's masterpiece story
Ended among her princes
They wished her to describe the picture
But she forgot her eyes
Upon the bridges' fences
A rhyme made of life
Attacked her burned senses
I adored Sofia
But the trees imposed ...

Read and leave comments (0)

sofialovewaymaserpiecestoryrhymepoetpoetryLOVE SONGLondonlove poemslove passionLove lostlove sonnetLongingloss of hairromantic distance love dan hookslossfalling in love

Waves (A Final Letter Home)

I lie and let the waves wrap 'round my feet,
As midnight skies perform the second act,
Where black and blue so effortlessly meet
And force the waters cold around my back.
I feel the sand bequeath my buried toes;
To let the grit defy my sodden skin
And as the open door to my soul grows
I let the frothy waters trickle in.

The moonbeams push my head into a daze
And buckle up t...

Read and leave comments (0)

deathwarpoemlosslovesoldierseaoceansoul

The Cottage II

Where are we now

Back to square one

Thrown to the beginning

Or have we moved on?

 

As the season changes

The cycle does reap

An autumnal harvest

That tastes just as sweet

 

There’s no place like home

Unearthed and unearthly

insecurity and fear still roam

Driven, dark and dirty

 

Trying to live the dream

Fucking, fighting and broken

...

Read and leave comments (2)

lovelove poemlove poetryIreland

NATALIE SERIES POEMS/BOOK

 

Natalie is a unique lady who we can all identify with. She's a warrior woman who fought in the Malvinas/Falklands war and was badly wounded. Many of her friends were murdered for having different views, they were a few of The Disappeared. Over time she believes in peace and moves away from war. Natalie has a goth band and a red stunt aeroplane both called Mayo. Check Nat's story out. She ...

Read and leave comments (0)

war to peacehuman journeyloss of lifecostwarwarplanemalvinasfalkandslove

dream sequence

.

 

 

 

In a dream of night, before me rose
I walked along an endless shore;
moist sand glowed a silvery pink,
danced to bright but waning sun;
its length moving, curved around
dotted by stars that formed a heart.
 
I peered ahead and looked behind,
shifted my gaze from side to side;
waiting to catch a fleeting glimpse,
to freely fall into...

Read and leave comments (0)

Dreamfriendsfriendshiploverelationshipsurreal

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message