BEAUTY (Remove filter)

Sonnet: Imigh Hotovely, Imigh Smál Damnaithe! Imigh is Póg mo Thóin! [Out Hotovely, Out Damned Spot! Out and Kiss my Arse!]

The 1st stanza asks a question to which the answer is, of course, “No”. John Milton wrote Areopagitica, an argument against censorship.

Sadly, in the Britain of 2025, poets, artists, journalists, religious leaders and The Man on the Clapham Omnibus now face routine harrassment by the UK Government and the police, enduring arrest and imprisonment without charge or trial: and for what? for oppos...

Read and leave comments (0)

censorshipJohn Miltongenocideethnic cleansingIrishpoetsartistsjournaliststruthtyrantsartbeautybardsCable StreetThe StruggleJihaadIntifadafascismtools

You Shine On Me

How special you are

To have laughter that infects

Bottomless: it goes on and on

How magic you are

To make every day an art

To make life come undone

To make the mundane fun

To perk up everyone

And spread a mood

Like waves until the whole scene

Becomes your sea

How special you are

To capture the heart

Of a wild beast that

Saw life as being free

To make th...

Read and leave comments (2)

loveromancepartnershiprelationshipteamthe onehealthymagicinspiredodededicatedinfluencedpowerfulbeautyblissinfatuationhappyexcitinghopefuldreampersonrealsunshineinspiringawefascinationluckythankful

Begin once again — The prophecy, Foreseen destiny — A happy ending

Beautiful to be fallen in a love with you my beloved

A union two twin flames

theirs
one old soul’s
shared nostalgia

about
our actions, how we react
an intertwined mind
quale, in the way we act
an ordeal with life
born into circumstance

chaotic
the conundrum
all of the elements and alignments required
the complexity of an immaculate conception
the manifestation of a woman and...

Read and leave comments (0)

🌷(1)

loveweddingnaturegodmetaphysicsfriendsfamilypoempoetpoetrypoemswriterspiritualspiritualityoccultmakeupfashionbeauty

The Beauty in Despair and Illusion

It is here that lies your beauty
do not testify to me anymore
of dandelions and daffodils
of butterflies and bees
do not sing like crows
beyond the dispersion of sight
then gather
in cold bare trees
sick with
discord
dislike
misfeasance.
The reward for
transgressions
destroys the cache
of elegance
of magnificence
of splendor
do not pour out sadness
breathless
from your panting ...

Read and leave comments (2)

🌷(5)

sightbeescrowscoldsickbeyondbeautydiscorddislikesplendorabysshopesadmirationsoulcolorsconclave

Haiku for 2025 [No 2]

Be thou my vision,

All that is most beautiful,

Most life affirming.

Read and leave comments (1)

🌷(6)

haikuvisionlifebeauty

Southern Lights

The lights you seek are not these ones, these are mine

I shall explain more in time

As I have searched far and wide

Yet these are the most beaufitul I find

Unique, like tears in the snow

 

I share these lights with the Emporer, Leopard and Crabeater

With an hour of sunlight, there's nothing more sweeter

Than to sit and watch the carnival of light above

On my own, as the ...

Read and leave comments (0)

🌷(5)

lightshopetimedepressionsadbeauty

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(6)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

This is not a draft

 

I don’t want to mask my poetry

I want you to understand me

Curse your perfect rhythms, rhymes, haikus

Your lyricism, your literary

When I try to adopt it, I turn mute.

Something channels through me

(I’ve never really found the root)

A demanding stream of consciousness

That cannot stop to breathe, let alone

Wait, conceptualise, draft, redraft

I can’t!

...

Read and leave comments (4)

poeticstyleformformatliterarytechniquestanzarhythmrhymehaikulyricismstream of conciousnessfreedomfreetalentcraftdraftperfectproofeditrulesconfinesartmetaphorsdebatebeautyimagerysubjectivevoiceunderstandconnectemotionfeelingsmotifswordsmithtransparentloudboldunfilteredaccessibletruthmask

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Doe

Wide eyed gaze
And lusty lashes
"You and those doe eyes"
He'd say
Before he hunted
And feasted

In my eyes, what did he see?
Shades of browns and yellows?
Hues of blues and greens? 
The girl of all his dreams? 
Someone he could love?
An angel from above?
Or did he only see himself?

A hunter on attack
Hoping to fulfill some predatory promise
Sensing a weakness
Smirking at the bre...

Read and leave comments (1)

🌷(5)

eyesbeautyEMOTIONAL POETRY

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

just walk away

pack your bags
and
go get ready

to walk the walk
through the traffic
of differing directions
wave down the runway
and remember…
never, look back

Read and leave comments (0)

modelingbeautyfashionnaturemodellovegodspiritualmetaphysicspoetpoempoems100 best poetry blogs

questioning my destiny

In my study,
the test subject,
had to have
strands
of  this
genus’ genotype
“A” and be
exhibiting these abnormalities

Read and leave comments (0)

schoolNaturelovepoempoetrypoetmetaphysicsspiritualgodbeauty

Summer breeze and the bee’s knees

The sky’s serenity

The sun’s strength

Mother Nature’s pride and poise

Earth’s balance

A bouquet of beauty in every way

The stillness between the trees

The calmness of the wind’s whispers

The modesty of mother nature; sacred and serene

The breathtaking beaches

The comfort of a campfire

The boisterous BBQ gatherings

The coziness of a cabin

With sun-kissed skin

...

Read and leave comments (0)

summerbeautymother nature

On The Train This Morning

On the train this morning
I sat alone, by the window
Where normally there’d be coffee, warm
and all the world’s news in my ear

Instead, I chose dry silence
I chose the undulating wildness
strobing past my view way
I chose high green hills
and glinting mirrored rivers 
I chose lone trees, centuries old
strong against the elements
I chose lambs and sheep
moving in pairs or herds
I cho...

Read and leave comments (4)

peacetrainmindfulmindfulnesscountrysidebeauty

makeup sex

Ugh
Beauty standards ...
 
makeup your mind
you said you'd be ready
an hour past ...
you haven't changed at all
I'm leaving you
 
While i tease your hair,  suck it up
I'm head over heels in love

Read and leave comments (0)

beautymakeuplovenaturespiritualspiritualitypoempoetrypoetvalentinesvalentinesday

Beauty

Your beauty makes YOU invisible

Do people see the real you or just your beauty? 

Beauty is a barrier 

I broke the barrier 

Read and leave comments (1)

🌷(4)

Beautysoulrealyou

Beauty

I see it time and time again

that beauty’s made by what is spent.

 

A beauty that demands a price

with outer glow and inner ice.

 

And observation seems to tell

it’s only as deep as the well,

 

for come the day the well runs dry…

such beauty simply waves goodbye.

Read and leave comments (0)

🌷(2)

beautyfake beautyouter beautyvanity

To a Fellow Artist

To a Fellow Artist

 

It’s often asked: wherein does beauty lie,

In mystery bound, proportions magical,

Deciphered only by the observer’s eye,

Or in some poet’s words deemed lyrical?

I know that beauty’s not in sparkling dross,

Perfection is for fools; an empty frame,

In masterpieces, lines are found and lost,

And here, in life’s chiaroscuro lives a flame,

A caring smi...

Read and leave comments (4)

🌷(7)

artiststruthbeautyfreedompoets

Dragonfly

Most beautiful dragonfly you ever did see.

Descends to land upon my left knee.

We looked one another deep in the eye.

Then with a wink, it flew away into the sky.

 

www.deanfrasercentral.com

Read and leave comments (0)

🌷(3)

poetrynaturebeauty

Grandfather & I

I am Misti--, didn't get it?
Misti(sweetness) is my name,
My grandmother gave me that
Honor, I'm too grateful.
I'm going to 8 months
This November soon,
My limbs are
Not properly working now,
As a little bird fears to fly
Into the sky, below the mountain,
I am quite like that: I can't
Hold my legs sticked to ground.
My voice is like the groaning
Of the cloud you can hear but
Not to d...

Read and leave comments (0)

lovebeautypoemmemorylife

Seek And You Will Find

During the American Civil War, which ended in 1866, Walt Whitman worked as a clerk in Washington, DC. For a period of three years, he cared for soldiers, dressing their wounds, and comforting the injured.

His 1865 publication of poetry, Drum-Taps, which drew from his experiences in the civil war, includes, “When Lilacs Last in the Dooryard Bloom’d,” Whitman’s elegy for President Lincoln.

I ...

Read and leave comments (0)

🌷(2)

Jubilee SingersAmerican Civil WarWalt Whitmanbeautytruth

On Beauty

My love of Beauty, nurtured through the years,     

Of form and fair proportion’s served me well.    

Yet often I ask: where does my true love dwell?   

Within my soul; this heart; these eyes; or ears? 

Does she conduct the music of the spheres? 

Or, sit in silence sweet on Lakeland fell? 

Are roses’ heavenly scent bound by her spell?    

Her spirit surely lives in all...

Read and leave comments (3)

🌷(5)

BeautyTruthLakelandrosesmusiclife

Beauty in Ugliness

We believe in good things easily

But hard to confide in bad ones,

(Beauty tells us the jovial story

But often it throws the dark rays

Into our smiling face.)

 

We know if the flowers

Bloom, they must give sweet fragrance

To the air, but we often forget

Some are odorless. Some flowers which

Bloom beyond our vision are full

Of sweet nectar but we don't care of them.

...

Read and leave comments (2)

🌷(8)

beauty

The Curve of Her Neck

I like the curve of her neck

And her lightly tanned shoulders

I’m not interested in the drinks I’ve bought

Well, not as much as the way she has crossed her legs.

I like the way her mouth moves

Though I’m not interested in the words

Another part of me answers

And nods my head in agreement of something

Although inside

Inside my head

I rather like the curve of her neck.

...

Read and leave comments (0)

🌷(6)

womenbeauty

america is a beautiful speech

speech of a term is speech of a speech
speech is speech of a speech
speech is speech of america
america is a figure of speech
speech is a term of speech
speech is a term of america
america is a term of america

america is a beauty of a beautiful speech
beauty is beauty of a magnificent speech
beauty is beauty of a magnificent term of speech
a beautiful america is the beauty of america
...

Read and leave comments (0)

🌷(2)

poemspoetryamericaspeechbeauty

Beauty

Where do we all find beauty?
And of what does it consist?
Is it made or is it natural?
And where does it exist?

One might find it in a person.
They may have lovely hair or eyes.
Or is it in their personality?
Is that where beauty lies?

Do we find it in the weather?
Perhaps it's in a summer's day.
With blue skies and precious sunshine,
And we'd love for it to stay.

Do we discover ...

Read and leave comments (1)

🌷(8)

Stuart VannerBeauty

bird watching

gracefully i perch on the edge of the bus seat, 

so as to convey my feminine, my eyelashes. 

each time the doors open my posture rushes to fix itself, 

my fringe blown out by my hands running through it. 

when i'm most worn out, 

on the days when the world is dragging its feet,

when my joints tingle with pins and needles. 

to look pretty on the edge of a bus seat is a fufillin...

Read and leave comments (0)

🌷(7)

poempoetrypoetwritingwritergirlhoodnon fictiongirlsfeministbeauty

Show more entries …

This site uses only functional cookies that are essential to the operation of the site. We do not use cookies related to advertising or tracking. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message