Donations are essential to keep Write Out Loud going    

birthday (Remove filter)

Star seeds ‘n’ the Cosmic egg - of life

Dewy lotuses, 
grow in the dark -
creating an entangling —
Flower of Life …

nature and everything — we know — has its roots
on the grounds of truth
indeed…
every family tree,
needs...
a tree house.

Habitats for Humanity  

There is a lone wolf
which is black,
and blue,
in the eyes :
whom sees the world differently
depending on —
whether or not you’re 
— on his or her good or...

Read and leave comments (0)

birthdayhappybirthdayoccultmetaphysicsspiritualmetaphysicalnaturelovepoempoetrypoetspiritualitygodtruth

Aethereal protégée

Universal consciousness is omnipresent
— living vicariously, we too are one - and the same,
Having the time of our lives
all knowing— enlightened divine sparks
going —Godspeed.

This is a way of life:

Anatomic amino acid building blocks chain letters,
into the complex double helix;
in our initials is a chemical signature—me and my significant other have between us—
this bond, that
she...

Read and leave comments (0)

Naturespiritualityspirituallovebirthdaymeditationepicpoempoetpoetry

Journey

Entering into today’s day and age, we take turns turning the page.

Let us begin,
as were taken back to a time— lined with the new heights of always measuring up to ones expectations.
Ascendant signs are all "GO".
birthmarks placed on the face of the earth; add attachment to the earthly plane, and embody rebirth.
the fabric of the universe tucks us away—as our materialization is made—from a ...

Read and leave comments (0)

astrologyastronomybirthdaycreationjournaljourneylovepaperpoempoetryromancespirituality

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message