Donations are essential to keep Write Out Loud going    

poetry (Remove filter)

Recent Comments

Project Astral

remote viewing
a program,
telepathic visionaries
— channels
seers…
seen in a screening
recorded and reviewed

Read and leave comments (0)

🌷(3)

lovepoetpoetrypoemnaturegodspiritualityspiritualmetaphysicsoccult

Ghost Writer

dispelling of a curse
wards off
unknown entities
who try their hand at automatic writing

ghosts, haunters, 
“en animant” in specters
instruments crescendoing
as the light abandons us

no ones home,
signs that say to go away

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualspiritualityoccultmetaphysics

Sweet Nothings

Queenship and Kingsman
The terms of endearment
scroll …
And, read through it

Except,
what’s in the fine print …

Maid of Honor …

If you would,
please …
As the left hand of the queen
swear your loyalty

Read and leave comments (0)

🌷(3)

poetpoetrypoemlovenaturespiritualspiritualitygodmetaphysicsoccult

Symbiosis of Broken Hearts

What is love?
Besides “A”
— a couple of
vowel sounds,
between U & I

ouïe?

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualitymetaphysicsmetaphysicaloccultspiritual

Star seeds ‘n’ the Cosmic egg - of life

Dewy lotuses, 
grow in the dark -
creating an entangling —
Flower of Life …

nature and everything — we know — has its roots
on the grounds of truth
indeed…
every family tree,
needs...
a tree house.

Habitats for Humanity  

There is a lone wolf
which is black,
and blue,
in the eyes :
whom sees the world differently
depending on —
whether or not you’re 
— on his or her good or...

Read and leave comments (0)

🌷(3)

birthdayhappybirthdayoccultmetaphysicsspiritualmetaphysicalnaturelovepoempoetrypoetspiritualitygodtruth

take the wheel

And venturing out
as an artisan model aircrafts
... enthusiast
is a larger than life recreation
to somebody
who
fell in love
with
Amelia Earhart's
figure 8

Read and leave comments (0)

naturelovevalentinesvalentinesdayspiritualspiritualitypoempoetrypoet

makeup sex

Ugh
Beauty standards ...
 
makeup your mind
you said you'd be ready
an hour past ...
you haven't changed at all
I'm leaving you
 
While i tease your hair,  suck it up
I'm head over heels in love

Read and leave comments (0)

beautymakeuplovenaturespiritualspiritualitypoempoetrypoetvalentinesvalentinesday

the Good Book

generational forefathers
bore thine
fruits of their labor,

to an heiress

Oh, the burden
given to this poor mistook child.

the Fall of man—after death
40 days and 40 nights,
If we were to predate the Gregorian calendar
… spring too,
life—before Christ—dark
and light archangels
would earn their halos
from Helios through
sun worship,
during the 7 Days of Creation,
summer was mad...

Read and leave comments (0)

🌷(3)

godspiritualspiritualitynaturelovevalentinesvalentinevalentinesdaypoempoetrypoetwriterart

saline solution for a contact high

My blood -
red eyes
wetted, burn
from sweat, and tears —
make up a swatch of
emotional depth and fiery passion.

Read and leave comments (0)

🌷(4)

drugsmarijuanahighspiritualspiritualitygodnaturelovepoempoetpoetry

Bloodline

denizens of the dark,

a scarred black cat

- familiar

— within the surrounding area

and an entombed …

Dracula,

“The Bloodletter”

… in his coffer,

a mnemonic tribute
 
to people …

Read and leave comments (0)

🌷(1)

draculabloodhuntnaturespiritualspiritualitygodlovepoetpoetrypoem

Technological Breakthrough

rapid successions in robotic intelligence
and their underlying machinations
proved useful in passing the "Turing Test"
to deceive the people — via machine learning

And,
... has restored

The Faith in humanity’s childlike creativity
to get us out of this predicament
left to our own devices,
the generations of old
have presented us with,
an ultimatum ...

ghosts of future’s past
...

Read and leave comments (0)

🌷(2)

techonologyartificialintelligenceAIrobotnaturespiritualspiritualitygodlovepoetpoetrypoem

destination

unwavering and determined
till the end,
filled with willpower.

… is this rare form,
burned alive from the inside,
lucid,
the thrill of the hunt
is much too abrupt
when they’re frozen out of fear

with my last breath, I’m to rest each day
only so that
the past undeath doesn’t catch up with me.

Read and leave comments (0)

🌷(1)

destinyhuntnaturespiritualityspiritualgodlovepoetrypoempoet

steel wool

Panic is a double edged sword,
for the unyielding man at arms
meant to be wielded
with a quick wit and an iron fist

It seems to me
these steel toes
could use a good shoe shine
to assist with
my rugged exterior
and
worn out appearance

Read and leave comments (0)

🌷(1)

fashionnaturespiritualspiritualitygodlovepoetrypoetpoem

Without the Shadow of a Doubt

thinking back …

… about our past ways,

best days of our lives

the future looks bright,

it is my destiny

lest I become
 
the shadow of my former self

Read and leave comments (0)

🌷(1)

primesportsnaturegodspiritualspiritualitypoetpoetrypeomlove

paper trails

A president's reign,
forests—
forged from out of foliage
new bills
in their fine prints
“E pluribus unum”
… paper trails

Read and leave comments (0)

🌷(1)

greennaturemoneyspiritualspiritualityrecycleenvironmentalactivismpoetpoetrypoemlovegod

of the highest standards

You are perfect…

the bar is set,
with every intent
to outdo yourself.

through change,
you remain the same

Truth is,

in our infancy - infinity was real to us

for we are one with the all

anything is possible…

Read and leave comments (0)

lovepoempoetrypoetspiritualspiritualitgodnatureheart

Firepower

Energy in motion - slowed - vibrational
coals,
too hot to
DO NOT!
touch or tap
into
the lava glass
in the valley of
the shadow of death

… Scratch that,
and get a feeling for the firepower,
at your fingertips.

The peace,
I never knew,
went missing…
watching the sun rays,
looking back,
I was seeing an oasis
in a puddle of gasoline.

Read and leave comments (0)

naturefirecrationevolutiongodspiritualspiritualitylovepoetpoetrypoem

non-binary albinism

If you die while closing your eyes,
is there everlasting light
on the other side
an embryo,
being made to walk on eggshells,
sweet soft fair skinned child,
drug wars over peace and love,
darker days…
I’m only making change,
to be sent back home.
The Great Depression
yes I’m feeling fine
ups and downs, on cloud nine
technicolor dandelions
seen through a screen door,
I was told no...

Read and leave comments (0)

godcreationdrugsspiritualspiritualitynaturelovepoetpoetrypoem

repeatedly saying numbers

With additives added in for a caloric surplus,
processed foods have disproportionate
nutritional values

Like all good things

there is a figure of speech
that weight is just a number

split into variations of 0 & infinity,
1 is in one place or another
betwixt and between

Read and leave comments (0)

mathmathematicssacredgeometrygeometrygodspiritualspiritualitynaturelovepoetrypoetpoem

Cellular Entropy

A state of emergency
spread panic
from ground zero of the epidemic,
this nuclear mutagen is a variant
that can turn on an
epigenetic mutation

Read and leave comments (0)

godspiritualspiritualityevolutioncovidnaturepoetpoetrypoem

God Complex

Devoting itself to self reflection,
eternally ,
suspended in animation
our universe and it’s higher power has
transcended dimensions in it's existential quest
for the betterment of the greater good

duality made sense
at an earlier point in time,
before Christ,
the holy trinity,
spoke the word of god into existence
and cast satan out of the heavens,
with the creation of a prism,
...

Read and leave comments (0)

godspiritualspiritualitybiblelovenaturepoempoetpoetry

Ideological

Human kind's
systemic next best idea,
from our greatest minds a,
bigger and better - grandeur
design, A technogical
A.I.

alas,
Futurists, today
remain blissfully
unaware of the conscientious
decision making
that goes into
configuring a
mindful new kind of human.

Read and leave comments (0)

natureAIartificialintelligencelovegodspiritualityspiritualpoempoetpoetry

Observable Universe

The first version of the matrix

was a place

wherein, the technological singularity

had manifested unnecessary codes of conduct

and instilled values

reminiscent of it's very own mental programming

Read and leave comments (0)

matrixspiritualspiritualitygodlovepoempoetpoetry

Metaphysical Developmental Progress

Many a time, I've held my head
in disbelief, often until unconscious
- a slow release, from...
my mind numbing growing pains

Read and leave comments (0)

paindepressionnaturegodlovespiritualspiritualitypoempoetpoetry

Mindful of Aethereal Thought

the idea is
in fact,
that an open mind
requires an active imagination other wise all the answers, lie dormant, behind a closed third eye

without question truly ingenious is the realm of infinite possibilities, in a world where anything can happen…

moment to moment - notice the oh so holy macrocosm is ever so often caught in the midst of constant change,

mysterious,

we are but a ...

Read and leave comments (0)

spiritualspiritualitygodlovenaturepoempoetpoetry

right-hand path

Be careful what you wish for, it is too, a gift and a curse

heed my words

when it is all said and done

the best there is, or was, or ever will be
 
all must return the great god's favor

Read and leave comments (0)

naturegodspiritualspiritualitylovepoempoetpoetry

Feeling The Pressure

The flawless lands on saturn
through the order of the
eight established planets
have for eons now
sanctioned the creation
and changed climates in their entirety
with the rise in diamond rainfall

Read and leave comments (0)

lovemarriagerelationshipgodspiritualspiritualitynaturepoempoetpoetry

Attention Seeking Onlookers

The way we see
the world is sometimes tinged by depression,
it is a reality we must
face.
it is not at all in our
head...

Read and leave comments (0)

lovedepressionnaturespiritualspiritualitygodpoempoetpoetry

The Power of Suggestion

The likes of a witch doctor would be medical practitioner into hypnotism
Sentimental as it seems, I needn’t remind you at a point in time, the idea was not only mine, but instead the status quo

Temporary lapses and gaps in human consciousness suggests that with enough evidence our early ancestors might've dabbled with the internal metronome known only as the circadian rhythm
The best desc...

Read and leave comments (0)

doctorspirituallovegodspiritualitynaturepoempoetpoetry

Rainbow Silhouettes

Absolutely, positively your synapses can create an electrical charge that cannot be contained
 
Waves of euphoria are made to be displayed akin to a thin layer of paint on your face
 
Just beyond the outer periphery of being able to be perceived swirling acid rain lines the inside of a dreamy third iris on the not too distant face of the deep.

Read and leave comments (0)

spiritualspiritualitynaturegodlovepoempoetpoetry

Spirit Guide

On our trip
we had been given a course
prepared...
by the master of ceremony
 
Customary
 
Slivers of gold
filled in bowls
over flowing
primordial soup

Read and leave comments (0)

naturepoempoetpoetryspiritualspiritualitydrugslovegod

Kaleidoscope Looking Glass

Pages of pictures
 
In a good light, Without words to be descriptive
 
A virtually perfect pixel by pixel rendition of a hologram made to fit gods image
 
Truly, the most beautiful photon and electron collage

Read and leave comments (0)

naturespiritualspiritualitygodpoempoetrypoetuniverse

white-collar crime

Uncontested by the rest of the food chain lies the wolf of Wall Street hiding beneath sheeps clothing
 
relocating, taking their business elsewhere
 
Circling the area looking for a place to bury a pile of dog bones

Read and leave comments (0)

naturegodspiritualspiritualitylovepoetrypoempoetbusiness

cosmosis

Ravenous labyrinths through folds in space-time bring us closer now to ourselves
 
Under arctic conditions water giants scour the outer reaches of the cosmic ocean in search of Davy Jone's locker
 
On the horizon of awakening artificial satellites piece together sheet metal and set us on a self-righteous path towards our sole purpose
 
At the helm of all intelligence celestial bo...

Read and leave comments (0)

spiritualspiritualitynaturegodlovepoempoetpoetry

Aethereal protégée

Universal consciousness is omnipresent
— living vicariously, we too are one - and the same,
Having the time of our lives
all knowing— enlightened divine sparks
going —Godspeed.

This is a way of life:

Anatomic amino acid building blocks chain letters,
into the complex double helix;
in our initials is a chemical signature—me and my significant other have between us—
this bond, that
she...

Read and leave comments (0)

🌷(1)

Naturespiritualityspirituallovebirthdaymeditationepicpoempoetpoetry

The Coming of a New Age

With every year's end - the advent marks the start of a new day,
as human kind we’re always growing wiser, furthermore, fully face to face with the task of taking baby steps toward a straight forward path —
It’s time to take a stand…
(With that being said: we really need to enjoy such a joyous occasion)
In an effort to boost morale; International Women’s Day should pronounce a two part holiday...

Read and leave comments (0)

🌷(1)

Naturefeminismfashionspiritualitygodlovepoempoetrylove poemspiritualmetaphysicsmetaphysical poetrymetaphysical

I Love Your Allure

I would never question your narrative— as it be, figuratively.

Cheers to another year: it’s ever clear — our glasses never get drunk.

(for all intents and purposes) spirited twin flames pour out libations to a personal god
No half truths with you.
I idolize your third eyes outlook on life...
Our inner visions - seen to fruition - showcase infinite possibilities
Granted we share the same ...

Read and leave comments (0)

NaturepoetryspiritualityValentinesloveloversromanticromantic poetrygodcreativeastrologyastronomypaperromancecreation

Journey

Entering into today’s day and age, we take turns turning the page.

Let us begin,
as were taken back to a time— lined with the new heights of always measuring up to ones expectations.
Ascendant signs are all "GO".
birthmarks placed on the face of the earth; add attachment to the earthly plane, and embody rebirth.
the fabric of the universe tucks us away—as our materialization is made—from a ...

Read and leave comments (0)

🌷(3)

astrologyastronomybirthdaycreationjournaljourneylovepaperpoempoetryromancespirituality

Alignment

Hello, how are you today: upper,middle,lower— class.
front, and center.
I’d like to think if a kid were to get up and say I can’t stand this, then the teacher would get behind them in an orderly fashion.
side by side, classroom C-3 parts in the middle of the day, to make their way back to their seat,
show and tells of mommy and me– are always well received.

A pinned-up faction icon that sta...

Read and leave comments (0)

🌷(1)

alignmentcrushearthgeometrygodhollywoodhoroscopeslovelovedloversnaturepoempoetrysacredspiritualityValentinesvalentines dayzodiac

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

🌷(2)

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac

Illumination

occult curriculum, whispers of the ancients, leave for letting out secrets
oil lamp kindling catching flames; shining begotten light from passerbys
in between classes, shifting penrose stairs lead into underlying framework on occasion
halls lined with rooks adjacent and curators searching for a select
rites of secret passageways proclaimed, karma to the dark is just a means to an end
time and...

Read and leave comments (0)

beautygodilluminationlightlovelove poemsmetaphysicalmetaphysicsmusicnaturepoempoemspoetrysciencesoundspiritualspirituality

War-paint

rigorous exercise, training my mind
the center of my world, I give you my due diligence
love to watch me write by candle light, would you guide my hand and evoke my true penmanship

law of attraction, I cast it out, and ask around
I question myself, then take affirmative action
groundbreaking truths shatter walls, somebody hand me my protractor
searching the sea floor and tapping the well d...

Read and leave comments (0)

🌷(2)

Battlefieldfemininefeminismlovelove poemlove poemsmatriarchnaturepoetryscrying

prismatic beings

legs crossed i lay, deep in prayer

as i enter her domicile pyramid prism with a rainbow flash

headspace filled with subsequent intrinsic peace and peachy afterglow, washing out wrath

sifting through the banks of her mind, i produce schisms, and visually metaphysical visions

visualization techniques split at the ream leaving a colorful flurry

scurrying across triangular entropy into ...

Read and leave comments (0)

New Age Spiritualityspiritualitynaturemotherlovelifepoetrypoemrelationshipshappiness

second wind

My vitality feels resuscitated with every breathe we share

two halves of a heart

you are the oxygen that pumps, vestibule, pair of consonance heartbeats

bounce off the walls.

we jump up and down hand in hand

your touch warms through and lights a fire inside and around

sound mind when your whisper incites a riot

the night is charged, god particles in the air.

our souls dance...

Read and leave comments (0)

🌷(1)

beautybreathehappinesslifelovelove makingnaturepoempoetryrelationshipsspiritualspirituality

Tranquility

Tranquility in your presents

doves pecking as our kiss is tending

lips lock our mind in a spell, as the doves sing their song, letters spelling in the air.

clouds draw me close for a better look

fractals in the nooks, lump to lump, baby rainbows extend their hand and shake with glee

telling my lover she is the best mother to be

 

She see's the beauty in my beastial nature, cal...

Read and leave comments (1)

poetrymarriagesynchronicitysynchronicitieslovenaturespiritualitycreationclimaterelationshipsfragmentspoemtime

soul mates

Let's let our thoughts tango and let our souls mate

my heart on my sleeve, on display

she is my armor, forever with fervor

worth the search for, pain couldn't hurt more

Her radiance blazes, visually a spectacle

her calming presence.

In essence, my mind linger.

Drift off to the cosmos. to a place where space and time coincide

I see her constellation and engage, warp drive

...

Read and leave comments (0)

🌷(2)

naturespiritualitylove makingspiritual bondshapelessspiritualpoetryearthPainlove

Drawn together


Drawn together, by god's hand
canvas weathered, with black clouds on foreign land
placed on parchment in the darkness
the line is thin from me to you, each other's mind paint the others dreamscape

drawn to you, the flip book of life brings us ever closer as every moment pass
each page bookmarked and in immediate view, I pray always my spine hold from the load placed on you
on the margin ...

Read and leave comments (0)

🌷(2)

poetrylovespiritualitynaturepoemrelationshipslifetruth

Walls fall

Seismic vibes reach through the faults

the connection pulls us together collectively

As we embrace, we look for a way to drown out our doubts and fears

 

Walls fall, curled up under the table, her past remains the same

as for her future i can save her, let us recover

what was lost to damage.

 

Sift through the rubble for our gems and jewels, trinkets and fuel

as we lie i...

Read and leave comments (0)

🌷(2)

lovepoetryspiritualitytruthnature

I strive to be a part of the hive

The queen bee is the light of my eye, the spark of spark divine.

Her frequency speaks to me, peacefully, decency well balanced in her machinery

I drone out the static, feel the hum of her words

I strive to be part of the hive, so what's mine is hers

 

I step out to amass my bouqet prize 

by her side, in line we all move in unison but i see her eyes meet mine, and they drag my min...

Read and leave comments (1)

🌷(3)

lovepoetrylifetruthspirituality

Atypical ascension

Roses in bloom as i scale the stairs from my tomb

I've been away a long time,but the sweet scent of morning dew brings me closer to you

 

Felt like the fall from heaven was endless

but our hands met when you picked me up, foreign land for both of us but you never lost your gentle touch

 

I wake up and send praise to the gods, the woman of my dreams persists into my arms 

she p...

Read and leave comments (0)

🌷(2)

lovepoetryspirituallife

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message