Poetry Blogs (poems)

poems (Remove filter)

Popular last 30 days

To Breathe (Is To Burn)

 

There is so much more to this.

The music does not make song

but the foetal space

amongst famous walls

filled with such au fait grief

and there a beast floats

to see the fear fleeting

on their new found face

in some unfailing destiny,

there she silently screams,

a flame away

God so violently benign

in his passive spirit-

He forges her-

to breath truly ...

Read and leave comments (2)

burnchildfiregodmusicnewpoemssadnessverse

the moon knows more than us.

the moon knows more than us 

 

 

its hard to love her. 

it’s hard to love the person your mother sees you to be. 

it’s fun to love you. 

pretty to love someone like the moon does. 

 

there are no words on my mind nor my tongue, yet i speak to you, no clearer than two minutes younger.

if we stay beneath these sheets, the day will fade

and your wondrous lips will move u...

Read and leave comments (0)

and suncoming outi love herlifepoemspoems for the moonsapphic

Anxious Ground

this bizarre plea for that dystopia

dug here with slumber  

which might sleep for friendship.

maybe creep and demise passing,

a prayer and an assembly,

me and God in his chamber,

a euphoric chalice

that grasps a spade to dig

but who am I to find such bliss in the anxious ground?

I take a spade and dig

but who am I to find such bliss in the anxious ground?

 

 

...

Read and leave comments (0)

blisscovid-19friendshipgodpoems

Days

my days wash up like the shore trying to remember which day I can restore how I could of did something different or maybe its all a enigma whatever my come to be will be I just hope it all works out for me 

Read and leave comments (0)

poems

Road By Road (Write it Slow)

Road by road I turn the car

and travel a phrase to a line,

move a sentence to plural,

then to verse to vent a thought,

but within the limit,

as speeding is futile anyway.

[2020]

Read and leave comments (2)

fun poemspoemsroadstechnique

Smoke and Mirrors (A Letter to Section Twenty Eight)

If only you saw they loved the smoke.

Know it were the shapes frolicking space

forming air they cheerfully choke on,

take a glass. Scoop it up drink it for them

swallow the haze, spittle on the mirror

mist this muse with thick saliva

so together they can press lips.

in the dusk where ignorance is shade,

the same as she and he did.

[2020]

Read and leave comments (1)

lovepoemspridesection28

God or a Vision?

you and your psychedelic phrases

did they plunge from your tailing tongue?

perchance I took breaths from the room,

exhaled, and put them back in your mouth

moving, placing my ear near your lips,

pausing for an air lick near my neck-

lifted eyelids and confusion  

so, then the comfort could come

when I would speak your surroundings-

the bed, the door, and the soft sheet

...

Read and leave comments (0)

afterlifegodpoemspower

This Stranger in the Room

you crawl yourself forwards

wearing their feet

among spindled legs,

those limbs are anaemic

and cannot amble

the room into a door,

boughs teeming with another’s blood

it’s soft tissue from another’s film,

I follow it now-

see this copied onto

your corpse I might watch,

and see this stranger in the room,

and feel a stranger feign their face,

claustrophobic bre...

Read and leave comments (0)

FrankensteinGothicpoemsstrange

The Poetic Bond X - call for submissions

The Poetic Bond X - calls for submissions - up to four poems on any subject, in any form, and of any length (120 lines in print + weblink).  

So far 623 poems from 223 poets have been published in The Poetic Bond Series.  The Poets of The Poetic Bond come from all over the globe, from the US to Malaysia, the UK to the Lebanon, with ages ranging from 14 to 86, exploring themes of love, life, age...

Read and leave comments (0)

poemspoetrypoetsthepoeticbond

Touch The Universe

direct your gaze skyward.

I see your eyes slip through

lens and the light shoot down,

orbit in your twitching

left to right,

left to right

panning light in soft night,

oxymoron of telescope

gathers perception -your feet-

fall here and your stare there

pinned to the pit of ground,

grate your phrase from fireplace.

and divide.

put syllables in pen,

cross out...

Read and leave comments (1)

comparisonfreedom of poemsliberationmetaphorspoemsself critical

Redemption in the Water

drown in egoism.

how we forget – don’t.

for flicker- shift  

this shell ashore,

revive the rolling

carcass and dissect,

drag that black heart

with the colour waves,

bleaching comatose

vanity that presses

with weight of our bodies-

 

we sunk like sinking

stripping skin for river,

it rowed,

it rowed,

wrapped with those oars

wallow, watch, wallow,

...

Read and leave comments (0)

poemsredemptionselfishnesswater

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac

Something

It has become an incorrigible habit

doing this, an innocent addiction

folding ashes to elegies,

pages fluttering to dust

twisted inside,

slow parching of the paragraphs,

I consume prose and set it alight,

a morbid obsession,

a novelists jealously

but don’t jump to put it out

cast those ashes,

let them call me

to tacit thoughts that cannot still-

feed my munda...

Read and leave comments (0)

freedom of poetrypoemspoetry vs prose

Nightly Routine

Late at night 
Lying in bed
Headphones on
Listening to music
Or a few recorded poems
Reading the latest 
I attempt to craft a new one
Or brush up a draft not quite finished

It’s becoming routine
I’ve always been
An undercover poet
Now I’m sharing my words 
With my family’s support as an added bonus

Shared are the happenings,
The disappointments,
The contests never won,
Submissi...

Read and leave comments (1)

familypoemspoetpoetry

Illumination

occult curriculum, whispers of the ancients, leave for letting out secrets
oil lamp kindling catching flames; shining begotten light from passerbys
in between classes, shifting penrose stairs lead into underlying framework on occasion
halls lined with rooks adjacent and curators searching for a select
rites of secret passageways proclaimed, karma to the dark is just a means to an end
time and...

Read and leave comments (0)

beautygodilluminationlightlovelove poemsmetaphysicalmetaphysicsmusicnaturepoempoemspoetrysciencesoundspiritualspirituality

This Is The Worst of Us

Dust settles,

silently against

their skin,

eyes glaring beside

gentle end,

those ticks turn forward

against face,

pacing rapidly

becoming ash,

floating in slow air

carried fast by words,

observed keen

paired with gunshots paced,

ignorance

in psychotic blood,

some dystopian

past flung like bodies,

without heart

those chants that fire hard,

Th...

Read and leave comments (0)

different stylepoems

The Coronavirus Poem

All too little, 
Too late 
As the Coronavirus 
Takes down the world by mistake.

Government officials standing behind gates
As it rains a blood of money
To keep the economy straight. 

Waking up the public to a doom
Which is highly frightening
For me and you. 

A war with the unseen.
Watching loved ones turning green.
Mortals inflicting pain and death.
Born from the innocent creatu...

Read and leave comments (0)

Corona virusdeathpoemsreallifevirus

Dwell

Those dulcet shadows

chased my figure,

dancing. a motif,

that refrained

to end of those pages,

a requiem of endless sobriety

to those euphoric seconds

lost to me.  

Read and leave comments (2)

memoriespoemsyears

Astral Breadth

A trestle table set with content and classical elements
places a coven with arenose intent in a safe space
their minds set on causing change—present occurences canvass Mandala by way of effect.
fascicle circuits blitz and singe might-have-beens
washing away strands emblazoned in ever apparentness
accommodating silver lining fringe wherein proper golden ratio leaves
their genus' plant matter ...

Read and leave comments (0)

astralchangelovemandelametaphysicsnaturepoempoemspositivityspiritualitywomen's day

The Papers

Witnessing their eyes glimmer,

as their lacerated heart was bleeding,

trying. I couldn’t pressure ignorance to clot-

blood pulsing while they leered,

relishing it-

the plasma seeping those callous headlines,

exhibiting grief in a page spread

with the hatred that slowly kills.

Read and leave comments (0)

newspaperphilosophypoems

A Shirt

Hands crept into the sleeve

as the buttons twisted

the shadow of cultural masculinity-

the callous cataloguing that jolts the collar,

I want to suppress fascination of scrunched stereotypes,

and iron the burns from my skin.

Read and leave comments (0)

poemsstereotypes

For the Poetry

There’s a connection 
A brief flirt
And before you know it
We’re going crazy over each other’s words
The list of reasons confirms you won’t be good for me
But it’ll make for some good poetry

We fool around, lift each other up
Take a drink from the lover’s cup
But watch out,
Don’t get in too deep
Remember this is only for the poetry

We circle around crazy ideas
The two of us in a be...

Read and leave comments (0)

desirepoemspoetry

Poems

Those thoughts and minutes

in verses

eighteen phrases per sentence

drifts in structure

ending in a full stop.

 

ink imperfect to hand that writes those letters

unique iteration of every character

to create those precious words.

 

that might emulate forte

or just mirror

a persona on the crumpled sheets

bound in the acquainted book.

Read and leave comments (0)

poems

splendid resplendence

in your essence I sense resplendence
could do no wrong by me, your personably impressioned defendant
your honor is what I strive for
it's why the day turns to night, sun and moon argue back and forth
fight about what's wrong and who's right, tug of war
light bends but doesn't break, shines through the prism, and is perceived in different waves

I met you once but my memory is starting to fade...

Read and leave comments (0)

dayLovelove poemlove poemsmoonnaturepoempoemsspiritualspiritualitysun

Disappearing Ink

You pen beautiful poems,

revealing hurts, worries,

secret desires of your soul.

Dancing on high wires,

creating cosmic alchemy,

then your words

are gone in a blink.

You must be using

disappearing ink!

https://youtu.be/lpsThfIqp18

Read and leave comments (4)

alchemychemistrycosmic beingPoemspoetryrelationshipssoul

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message