Donations are essential to keep Write Out Loud going    

Popular last 30 days

love Poem poetry depression sad life truth death nonet War

Popular last 12 months

Love poetry life poem nature death Hope war loss poet

birthday (Remove filter)

Recent Comments

John Coopey on Eradicating an old flame pain
1 hour ago

Reggie's Ghost on Wild Dogs
3 hours ago

rob1967able on tearing us apart.
4 hours ago

Manish Singh Rajput on Sitting To Write
7 hours ago

Manish Singh Rajput on Peninsula
7 hours ago

Carpe Diem on Breathe
7 hours ago

Tim Higbee on Peninsula
11 hours ago

Auracle on In memoriam...
13 hours ago

Auracle on Fred's dilemma
13 hours ago

Auracle on Another Shadow
14 hours ago

Aethereal protégée

Universal consciousness is omnipresent
— living vicariously, we too are one - and the same,
Having the time of our lives
all knowing— enlightened divine sparks
going —Godspeed.

This is a way of life:

Anatomic amino acid building blocks chain letters,
into the complex double helix;
in our initials is a chemical signature—me and my significant other have between us—
this bond, that
she...

Read and leave comments (0)

Naturespiritualityspirituallovebirthdaymeditationepicpoempoetpoetry

A Daughter's 18th Birthday Poem

Seasons come and seasons go

Through autumn’s leaves and winter’s snow

Sweet as summer berries you

A fresh spring breeze you carry through.

 

Though time flies fast, the passing years

Have bought us laughter, joy and tears

And now at last our daughter dear

Has reached her special 18th year.

 

So with all the love we feel inside

And all a mother and father’s pride

...

Read and leave comments (0)

daughterbirthday18th

14/12/1994

Here is to another year of life,

Should I be buoyant and forget these years of strife?

 

See my demons are growing more mature,

As I silently suffer no closer to a cure. 

 

24 years of carrying this unbearable pain inside,

Yet today I'll show the world I'm happy and hide these tears I’ve cried. 

 

En fin, feliz cumpleaños para mí

I hope these messages from back home b...

Read and leave comments (1)

Birthdaycelebrationlife

Journey

Entering into today’s day and age, we take turns turning the page.

Let us begin,
as were taken back to a time— lined with the new heights of always measuring up to ones expectations.
Ascendant signs are all "GO".
birthmarks placed on the face of the earth; add attachment to the earthly plane, and embody rebirth.
the fabric of the universe tucks us away—as our materialization is made—from a ...

Read and leave comments (0)

astrologyastronomybirthdaycreationjournaljourneylovepaperpoempoetryromancespirituality

Lockdown Birthday

Lockdown Birthday

 

We walked up from the river

Beneath a canopy of trees

The air was filled with birdsong

On a warm and gentle breeze

The sun was high in the June sky

The road stretched out ahead

We drank some wine together

shared cheese and new baked bread

 

After lunch we wandered home

The air was hot and hazy

Then we sat around and drunk beer

Refused t...

Read and leave comments (3)

napowrimo2017day24(85)birthdaylockdowncelebratingmaking the best of itsuncompanionship

Solar return

instances of mesmerizing glimpses vivify and lend clarity into an understanding of soul.

evocation leaves an everlasting mark as two twin flames embark from a space of divine love to create fate

meticulous minds pick a place and time, upon your arrival show a sign that's vital, gravity pulls us in for a kiss as our hearts meet.

my greatest wishes grant admission, a star is born and with t...

Read and leave comments (0)

astrologybirthdaycelebrationexpansivefemininityfeminismlightlovepeacepoempoemspoetrysolar returnsoulspiritspiritualitysun signwisheszodiac

Florida Birthday Girl

You wake me early, with a kiss-scapade and your eyes bright like the morning light that snuck through onto my pillowcase.

You open my car door with a knowing grin, and I make ridiculous guesses, but you refuse to reveal your plans.

First, across the bridges of Jacksonville, to historic Avondale, where old-Florida gardens and old-money mansions show us their frills.

My first time at the Fo...

Read and leave comments (5)

JacksonvilleFloridabirthdayRiversideAvondaleAtlantic Beach

Salutations for Sally

I wrote this poem for my wife's birthday.

Salutations for Sally

The years don’t pass slowly anymore,

But there’s still time for an eternity

In your eyes, in your arms, your love.

Each moment a step to infinity,

But time doesn’t march, it ascends,

And we rise on the years,

Sadder, yes, but wiser and

More loving, more understanding.

And you lift everything around you

...

Read and leave comments (0)

birthdaytimeagingeternity

HAPPY BIRTHDAY

Today is my birthday

not sure if I'm happy or sad

I'd be glad

if at 30

we started to count backwards

So many candles on my cake!!

I need a FIRE extinguisher...

By Lynn Hahn

 

Read and leave comments (4)

birthdaypoem

Happy Birthday Bill

Repost in memory of the 55th anniversary of his birth.

 

I love Bill Hicks (while being tickled)

    ...I love Bill Hicks (laughing)...

...no no, stop...

   ...I love Bill Hicks (laughing)...

...no I love Bill Hicks honest...

     ...hahaha...shhh...

...I love Bill Hicks behave...(laughing)...

    ...shh...stop it! I love Bill Hicks...

(wistfully)

Bill Hicks

dea...

Read and leave comments (1)

Billhicksbirthday

A Life's Wish

May you wake today
To see light of day
To hear nightingale
When you're feeling stale

May you rise
With sunrise
And seize the day
Without dismay

May you awaken
Feeling unshaken
And start a smile
For a long while

May you forever love
And feel being loved
May you follow your inner wisdom
And be guided to only success

Read and leave comments (0)

birthdayhopelifesuccess

Red Letter Day

The clock
Ticks
 
The minute
and the liquid
Chime
 
Vanilla scent
and gentle oak
Blend
 
The nose is pleased
The lips poised
The tongue
Ready
 
Then thirst, palate,
mind and soul are
Satisfied
 
The nectar and company
shared, valued 
Enjoyed
 
And a birthday
Celebrated

Read and leave comments (0)

winebirthday

Young and wrinkly

Young and wrinkly

 

You are not getting old

But numerically you've advanced

No, you're not getting old

You're just chronologically enhanced.

 

You are not growing up

But of this much I am sure

To avoid growing up

We must become more immature.

 

We must dance until our joints creak

And sing until we can't speak,

Laugh until our lungs ache

And love until ...

Read and leave comments (4)

Birthdayageyouthyoungwrinklyoldgrowing older

birthday

 

Staggering home alone, intoxicated

From another birthday now belated

Booze translates to insomnia medicated

I used to be an animal but am again domesticated

Read and leave comments (0)

birthday

Repost:

We Too Hold Truth

A dancer I know made a flag 

 For me

 It contains my favorite colors and

 Holds the spirit of a sloth

Deliberate and lazy

Slow but sure

Hanging upside down

And clear about the difference between

Sky and ground

My flag for my revolution

No nationalistic colors with stripes

Bars animals symbols or heroic images

Represents me - never has

I ...

Read and leave comments (0)

birthdayBTWflag

OpenMind 2nd Anniversary/Birthday Special

OpenMind return to Fuel Bar to celebrate our 2nd anniversary, exactly 2 years since the first ever OpenMind event at Earth Cafe.


To celebrate our 2nd anniversary we've created a few elements that pay homage to this number. Entry will be £2, we've got 2 headliners, 2 guests per genre, and raffle tickets will be 2 for the price of 1.


As always we'll begin the evening with the most...

Read and leave comments (0)

OpenMindAnniversaryBirthday2PoetryMusicAcousticHip HopFuel

OpenMind 2nd Anniversary/Birthday Special

OpenMind return to Fuel Bar to celebrate our 2nd anniversary, exactly 2 years since the first ever OpenMind event at Earth Cafe.


To celebrate our 2nd anniversary we've created a few elements that pay homage to this number. Entry will be £2, we've got 2 headliners, 2 guests per genre, and raffle tickets will be 2 for the price of 1.


As always we'll begin the evening with the most...

Read and leave comments (0)

OpenMindBirthdayAnniversaryPoetryMusicHip HopAcousticFuel2

My birthday/OpenMind 25th January full itinerary

As some of you may know there's a character limit on the event pages on here, so I've decided to upload the full itinerary so far for my birthday OpenMind event on 25th January at TV 21, 10 Thomas Street, Manchester as a blog for the OpenMind group page.

 

Everyone is very much welcome to attend my special OpenMind event whether they're first time readers, casual open micers or veteran ...

Read and leave comments (0)

OpenSpaceOpen MicPlansItineraryEventBirthdayOpenMind

Today Is My Birthday

 

Today, the 27th of May, Friday,

I celebrate another birthday.

I again thank God for prolonging my life,

For giving me the strength for the right strife,

For saving me from a danger,

For giving me a chance to understand a stranger.

For forgiving all my sins,

For congratulating with my wins.

Another year of my life has passed.

I hope it is not the last.

...

Read and leave comments (3)

birthday

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message